Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6A154

Protein Details
Accession A0A2C6A154    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-54GHPPAVRHDRQDRRRRPPDPBasic
NLS Segment(s)
PositionSequence
48-48R
88-99ARPKSSSRLARR
Subcellular Location(s) extr 12, mito 6, plas 3, nucl 2, cyto 2, cyto_nucl 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MIPSRPVLLAMLVSSGIAFAVRTLVGQDRESRRAGHPPAVRHDRQDRRRRPPDPTMPDVGWPAALGQSLLSTTFAECALSRPGERAAARPKSSSRLARRVSQPGNTRKKDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.04
5 0.04
6 0.03
7 0.04
8 0.04
9 0.05
10 0.06
11 0.1
12 0.12
13 0.14
14 0.21
15 0.25
16 0.29
17 0.3
18 0.31
19 0.3
20 0.36
21 0.37
22 0.38
23 0.37
24 0.38
25 0.45
26 0.51
27 0.49
28 0.46
29 0.54
30 0.56
31 0.61
32 0.68
33 0.69
34 0.72
35 0.8
36 0.78
37 0.75
38 0.75
39 0.75
40 0.71
41 0.66
42 0.59
43 0.5
44 0.47
45 0.41
46 0.31
47 0.2
48 0.13
49 0.09
50 0.06
51 0.06
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.07
64 0.08
65 0.11
66 0.12
67 0.12
68 0.13
69 0.15
70 0.19
71 0.2
72 0.24
73 0.31
74 0.38
75 0.4
76 0.42
77 0.43
78 0.44
79 0.51
80 0.54
81 0.54
82 0.55
83 0.57
84 0.62
85 0.66
86 0.7
87 0.68
88 0.67
89 0.68
90 0.69
91 0.75