Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5Z542

Protein Details
Accession A0A2C5Z542   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
71-94RLLALPCPQRRRDRFRRSRGMSWSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 7, extr 7, cyto 2
Family & Domain DBs
Amino Acid Sequences MPMPAADCTAIISIAVAVALCAPARLRFSCQPTQIANDKRRPVVPTPPPPLPLALPPSLSSSPFPSSLPVRLLALPCPQRRRDRFRRSRGMSWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.04
4 0.03
5 0.03
6 0.04
7 0.04
8 0.04
9 0.05
10 0.07
11 0.11
12 0.12
13 0.17
14 0.23
15 0.3
16 0.35
17 0.37
18 0.39
19 0.37
20 0.41
21 0.43
22 0.46
23 0.46
24 0.47
25 0.48
26 0.46
27 0.47
28 0.45
29 0.4
30 0.41
31 0.43
32 0.45
33 0.47
34 0.46
35 0.46
36 0.43
37 0.4
38 0.32
39 0.26
40 0.21
41 0.17
42 0.16
43 0.16
44 0.2
45 0.2
46 0.2
47 0.18
48 0.18
49 0.19
50 0.19
51 0.19
52 0.17
53 0.19
54 0.21
55 0.21
56 0.18
57 0.18
58 0.19
59 0.2
60 0.2
61 0.26
62 0.31
63 0.36
64 0.42
65 0.48
66 0.56
67 0.64
68 0.72
69 0.75
70 0.78
71 0.83
72 0.86
73 0.91
74 0.88