Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5ZX94

Protein Details
Accession A0A2C5ZX94    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-40SSARIKKNKKANNVKFKVRCHydrophilic
NLS Segment(s)
PositionSequence
23-30ARIKKNKK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPKEVADIKKFIEICRRKDASSARIKKNKKANNVKFKVRCQRHLYTLVLKDTDKAEKLKQSMPPSLHITDLSKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.5
4 0.45
5 0.51
6 0.54
7 0.53
8 0.57
9 0.6
10 0.6
11 0.66
12 0.69
13 0.7
14 0.74
15 0.72
16 0.72
17 0.74
18 0.74
19 0.77
20 0.79
21 0.81
22 0.77
23 0.78
24 0.77
25 0.71
26 0.68
27 0.64
28 0.62
29 0.58
30 0.56
31 0.51
32 0.48
33 0.47
34 0.41
35 0.35
36 0.31
37 0.28
38 0.25
39 0.26
40 0.22
41 0.21
42 0.23
43 0.27
44 0.31
45 0.34
46 0.39
47 0.41
48 0.46
49 0.45
50 0.46
51 0.46
52 0.44
53 0.4
54 0.35
55 0.34