Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6AIK1

Protein Details
Accession A0A2C6AIK1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MNRPPRLTRRRNRKHRAFYTSQSAMHydrophilic
NLS Segment(s)
PositionSequence
8-15TRRRNRKH
Subcellular Location(s) plas 19, mito 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003445  Cat_transpt  
Gene Ontology GO:0016020  C:membrane  
GO:0008324  F:monoatomic cation transmembrane transporter activity  
GO:0030001  P:metal ion transport  
Pfam View protein in Pfam  
PF02386  TrkH  
Amino Acid Sequences MNRPPRLTRRRNRKHRAFYTSQSAMDNLGFTLTSDSMGHFRDAPWPMVLMAFLGLAGETLYPVLLRLVVWALWRLAPGGSRTRDSLRFLLDHPRRCYTLLFPGGTTWALLGIIAALSCVDTLLIVGLDWGSAEVAGLSPGQRLAAALFQAAAARHAGMTPYNLAAVSPAVQFSLLVMMYISIYPIAMSIRTSNAYERRPVGVYRPEPVYDEDRGGSYLVRHMQQQLSFDLWYIFLGIFLLSISESAKIKDRNEPSFAIFPIFFEVVSAYCNVGISLGHPSVNSALSTKFSVVGKLIVCAMMIRGRHRGLPHHLDRAIMLPDEHLLVDAEPDERVRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.94
3 0.93
4 0.89
5 0.85
6 0.83
7 0.76
8 0.67
9 0.57
10 0.48
11 0.4
12 0.32
13 0.26
14 0.16
15 0.12
16 0.1
17 0.09
18 0.11
19 0.1
20 0.1
21 0.1
22 0.11
23 0.14
24 0.15
25 0.16
26 0.14
27 0.14
28 0.21
29 0.23
30 0.24
31 0.22
32 0.21
33 0.2
34 0.2
35 0.19
36 0.11
37 0.09
38 0.07
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.06
55 0.07
56 0.09
57 0.1
58 0.1
59 0.1
60 0.11
61 0.1
62 0.1
63 0.11
64 0.14
65 0.2
66 0.22
67 0.23
68 0.26
69 0.3
70 0.33
71 0.35
72 0.35
73 0.3
74 0.29
75 0.29
76 0.37
77 0.4
78 0.44
79 0.44
80 0.45
81 0.43
82 0.43
83 0.43
84 0.36
85 0.38
86 0.35
87 0.31
88 0.28
89 0.27
90 0.27
91 0.25
92 0.21
93 0.12
94 0.07
95 0.06
96 0.05
97 0.04
98 0.03
99 0.03
100 0.03
101 0.03
102 0.02
103 0.03
104 0.03
105 0.03
106 0.02
107 0.02
108 0.02
109 0.03
110 0.03
111 0.02
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.03
123 0.03
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.06
137 0.06
138 0.06
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.04
160 0.05
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.04
175 0.05
176 0.06
177 0.08
178 0.09
179 0.12
180 0.18
181 0.19
182 0.21
183 0.22
184 0.23
185 0.24
186 0.24
187 0.25
188 0.28
189 0.28
190 0.28
191 0.29
192 0.27
193 0.27
194 0.29
195 0.27
196 0.2
197 0.2
198 0.18
199 0.16
200 0.16
201 0.15
202 0.12
203 0.09
204 0.11
205 0.13
206 0.13
207 0.14
208 0.16
209 0.19
210 0.2
211 0.22
212 0.2
213 0.19
214 0.18
215 0.17
216 0.15
217 0.12
218 0.1
219 0.09
220 0.07
221 0.05
222 0.05
223 0.05
224 0.04
225 0.04
226 0.04
227 0.03
228 0.04
229 0.04
230 0.06
231 0.07
232 0.08
233 0.14
234 0.18
235 0.2
236 0.29
237 0.35
238 0.37
239 0.41
240 0.42
241 0.4
242 0.4
243 0.38
244 0.32
245 0.26
246 0.21
247 0.21
248 0.19
249 0.15
250 0.11
251 0.11
252 0.09
253 0.1
254 0.1
255 0.07
256 0.07
257 0.07
258 0.07
259 0.06
260 0.06
261 0.06
262 0.11
263 0.11
264 0.11
265 0.11
266 0.13
267 0.14
268 0.15
269 0.14
270 0.11
271 0.11
272 0.13
273 0.15
274 0.14
275 0.16
276 0.16
277 0.17
278 0.16
279 0.19
280 0.17
281 0.17
282 0.17
283 0.14
284 0.13
285 0.12
286 0.12
287 0.12
288 0.14
289 0.17
290 0.22
291 0.24
292 0.28
293 0.31
294 0.37
295 0.42
296 0.5
297 0.53
298 0.55
299 0.54
300 0.51
301 0.48
302 0.45
303 0.39
304 0.29
305 0.23
306 0.15
307 0.16
308 0.16
309 0.15
310 0.12
311 0.1
312 0.09
313 0.1
314 0.1
315 0.09
316 0.09