Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZYD7

Protein Details
Accession A0A2C5ZYD7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
166-212AWPRCSRRRAEAGRGRRRVCASWPGGPVRRRRRSPSRPPWPPPRLSSHydrophilic
NLS Segment(s)
PositionSequence
157-209GGPAGRPGGAWPRCSRRRAEAGRGRRRVCASWPGGPVRRRRRSPSRPPWPPPR
Subcellular Location(s) cyto 11, mito 5, extr 5, nucl 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039657  Dimethylallyltransferase  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF01715  IPPT  
Amino Acid Sequences MAADAAAAAAASEAPRRAPAEPLVVVLGATGTGKSELAVELATRFRGEIINADAMQLYEGLPILTNKMPVAERRGVPHHLLGHISAGDAPWDVDAFKRAATALMADIRRRGRLPILVGGTHYYVDPLLFPDVILDDVVLDRGDDGPAAAAASSRPAGGPAGRPGGAWPRCSRRRAEAGRGRRRVCASWPGGPVRRRRRSPSRPPWPPPRLSSGPSVGGGAAAASWEKSVARGKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.12
3 0.14
4 0.15
5 0.19
6 0.21
7 0.25
8 0.25
9 0.25
10 0.23
11 0.21
12 0.2
13 0.15
14 0.12
15 0.06
16 0.06
17 0.05
18 0.05
19 0.05
20 0.06
21 0.06
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.08
28 0.1
29 0.1
30 0.1
31 0.09
32 0.1
33 0.11
34 0.11
35 0.12
36 0.14
37 0.18
38 0.17
39 0.18
40 0.17
41 0.16
42 0.15
43 0.12
44 0.09
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.08
51 0.09
52 0.09
53 0.09
54 0.11
55 0.13
56 0.14
57 0.21
58 0.22
59 0.23
60 0.27
61 0.31
62 0.31
63 0.32
64 0.33
65 0.29
66 0.25
67 0.24
68 0.2
69 0.17
70 0.14
71 0.13
72 0.09
73 0.07
74 0.06
75 0.05
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.07
87 0.06
88 0.07
89 0.06
90 0.1
91 0.11
92 0.11
93 0.15
94 0.16
95 0.17
96 0.17
97 0.17
98 0.15
99 0.17
100 0.18
101 0.19
102 0.19
103 0.18
104 0.18
105 0.18
106 0.16
107 0.13
108 0.11
109 0.07
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.05
121 0.04
122 0.03
123 0.04
124 0.04
125 0.04
126 0.03
127 0.03
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.03
136 0.03
137 0.03
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.07
144 0.08
145 0.11
146 0.12
147 0.15
148 0.15
149 0.15
150 0.16
151 0.25
152 0.26
153 0.27
154 0.29
155 0.36
156 0.43
157 0.46
158 0.48
159 0.46
160 0.54
161 0.58
162 0.63
163 0.63
164 0.68
165 0.76
166 0.8
167 0.75
168 0.7
169 0.67
170 0.59
171 0.54
172 0.53
173 0.47
174 0.45
175 0.48
176 0.49
177 0.53
178 0.55
179 0.6
180 0.62
181 0.67
182 0.68
183 0.73
184 0.77
185 0.81
186 0.87
187 0.88
188 0.88
189 0.88
190 0.9
191 0.92
192 0.89
193 0.84
194 0.77
195 0.75
196 0.69
197 0.62
198 0.59
199 0.52
200 0.47
201 0.41
202 0.37
203 0.28
204 0.22
205 0.19
206 0.13
207 0.08
208 0.05
209 0.05
210 0.05
211 0.05
212 0.06
213 0.06
214 0.1