Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5Z8B4

Protein Details
Accession A0A2C5Z8B4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-97THTPDRPTTRARRARREPWLTWHydrophilic
NLS Segment(s)
PositionSequence
87-91RRARR
Subcellular Location(s) mito 17, nucl 6, cyto_nucl 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MRPRPPAAAVTSQHRPSCARRGSRIKDKAMPRSSPAPRGDGVPAYQVQTARGGDSGAGQGLSVPPSDTLLPLLLATHTPDRPTTRARRARREPWLTWQRPQPQKKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.41
4 0.48
5 0.5
6 0.48
7 0.52
8 0.61
9 0.68
10 0.75
11 0.77
12 0.73
13 0.73
14 0.73
15 0.74
16 0.7
17 0.64
18 0.57
19 0.58
20 0.56
21 0.55
22 0.5
23 0.42
24 0.36
25 0.36
26 0.33
27 0.25
28 0.22
29 0.17
30 0.16
31 0.15
32 0.16
33 0.14
34 0.13
35 0.14
36 0.13
37 0.11
38 0.1
39 0.09
40 0.07
41 0.08
42 0.07
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.05
49 0.04
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.08
63 0.11
64 0.12
65 0.13
66 0.16
67 0.2
68 0.23
69 0.31
70 0.38
71 0.45
72 0.54
73 0.62
74 0.7
75 0.75
76 0.81
77 0.84
78 0.83
79 0.76
80 0.77
81 0.8
82 0.74
83 0.71
84 0.71
85 0.7
86 0.72
87 0.76