Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5YXA8

Protein Details
Accession A0A2C5YXA8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
14-34RELARRSRRFAQHQGKKRHMSBasic
NLS Segment(s)
PositionSequence
17-37ARRSRRFAQHQGKKRHMSGWP
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSIRLVPPPFLPGRELARRSRRFAQHQGKKRHMSGWPRARTVQSPARRTKTLVCARGPGLRPAVDGCELICFWPARLAFGGELGECRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.43
4 0.52
5 0.56
6 0.6
7 0.65
8 0.66
9 0.66
10 0.72
11 0.74
12 0.74
13 0.78
14 0.82
15 0.82
16 0.78
17 0.72
18 0.67
19 0.62
20 0.6
21 0.61
22 0.61
23 0.57
24 0.55
25 0.55
26 0.51
27 0.46
28 0.44
29 0.42
30 0.4
31 0.42
32 0.46
33 0.49
34 0.48
35 0.48
36 0.46
37 0.48
38 0.48
39 0.46
40 0.41
41 0.39
42 0.4
43 0.45
44 0.42
45 0.35
46 0.3
47 0.25
48 0.24
49 0.22
50 0.23
51 0.18
52 0.16
53 0.13
54 0.13
55 0.12
56 0.12
57 0.14
58 0.12
59 0.11
60 0.16
61 0.16
62 0.16
63 0.17
64 0.19
65 0.16
66 0.17
67 0.18
68 0.13