Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6A2I0

Protein Details
Accession A0A2C6A2I0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
225-252APPSGGVTKKKSPTRKVRFKDAESQKIAHydrophilic
NLS Segment(s)
PositionSequence
112-122PRARRRRSGTP
191-242RAAKRRQQMAEYRRREENEARARRSQRRRGDAAAAPPSGGVTKKKSPTRKVR
Subcellular Location(s) nucl 12, cyto_nucl 10.5, mito 8, cyto 7
Family & Domain DBs
Amino Acid Sequences MSDPSSPAATPKRKRGQELPVTPIKFSFDPATVQSPEDGSQSPQSSVAHRFRGLALGGADDAETADVVRKRRRPDDYVLAARPESPSSRGPPRPVPPLAAIGSVEAAADGGPRARRRRSGTPPLRLKASPAAQGGEPMVDQDEVPLADPVRAALTWHEDEITVYDPDDDDDDGTGINGVGFKPTPALAHARAAKRRQQMAEYRRREENEARARRSQRRRGDAAAAPPSGGVTKKKSPTRKVRFKDAESQKIAVTTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.77
4 0.77
5 0.77
6 0.73
7 0.72
8 0.67
9 0.6
10 0.53
11 0.47
12 0.36
13 0.32
14 0.28
15 0.21
16 0.22
17 0.24
18 0.29
19 0.25
20 0.26
21 0.23
22 0.22
23 0.21
24 0.21
25 0.19
26 0.16
27 0.2
28 0.21
29 0.21
30 0.22
31 0.22
32 0.23
33 0.3
34 0.33
35 0.32
36 0.31
37 0.32
38 0.3
39 0.32
40 0.28
41 0.23
42 0.17
43 0.13
44 0.13
45 0.11
46 0.11
47 0.07
48 0.07
49 0.05
50 0.04
51 0.03
52 0.08
53 0.11
54 0.16
55 0.23
56 0.28
57 0.35
58 0.43
59 0.49
60 0.5
61 0.55
62 0.6
63 0.61
64 0.63
65 0.58
66 0.52
67 0.46
68 0.41
69 0.35
70 0.27
71 0.2
72 0.17
73 0.18
74 0.21
75 0.29
76 0.33
77 0.36
78 0.41
79 0.44
80 0.48
81 0.46
82 0.44
83 0.37
84 0.37
85 0.33
86 0.26
87 0.22
88 0.15
89 0.14
90 0.11
91 0.09
92 0.05
93 0.04
94 0.03
95 0.03
96 0.03
97 0.04
98 0.08
99 0.12
100 0.17
101 0.2
102 0.26
103 0.33
104 0.42
105 0.49
106 0.58
107 0.62
108 0.67
109 0.72
110 0.68
111 0.65
112 0.55
113 0.49
114 0.43
115 0.37
116 0.31
117 0.24
118 0.23
119 0.19
120 0.2
121 0.18
122 0.12
123 0.1
124 0.06
125 0.06
126 0.05
127 0.05
128 0.04
129 0.05
130 0.05
131 0.05
132 0.06
133 0.05
134 0.05
135 0.05
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.11
142 0.11
143 0.11
144 0.11
145 0.11
146 0.11
147 0.12
148 0.13
149 0.08
150 0.08
151 0.08
152 0.08
153 0.08
154 0.09
155 0.08
156 0.06
157 0.06
158 0.06
159 0.05
160 0.05
161 0.05
162 0.04
163 0.04
164 0.04
165 0.04
166 0.05
167 0.06
168 0.06
169 0.07
170 0.07
171 0.08
172 0.09
173 0.14
174 0.14
175 0.2
176 0.27
177 0.32
178 0.39
179 0.43
180 0.49
181 0.52
182 0.56
183 0.53
184 0.54
185 0.57
186 0.61
187 0.67
188 0.67
189 0.63
190 0.63
191 0.63
192 0.62
193 0.58
194 0.58
195 0.58
196 0.6
197 0.61
198 0.64
199 0.69
200 0.73
201 0.78
202 0.77
203 0.77
204 0.76
205 0.77
206 0.73
207 0.73
208 0.68
209 0.66
210 0.62
211 0.52
212 0.43
213 0.37
214 0.33
215 0.27
216 0.24
217 0.21
218 0.21
219 0.29
220 0.38
221 0.47
222 0.57
223 0.65
224 0.74
225 0.81
226 0.85
227 0.84
228 0.87
229 0.87
230 0.83
231 0.84
232 0.83
233 0.81
234 0.75
235 0.7
236 0.59