Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZX96

Protein Details
Accession A0A2C5ZX96    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-41AERRSSGYKSWKKKYRKMRIRFDQKMQQGHydrophilic
NLS Segment(s)
PositionSequence
21-30KSWKKKYRKM
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR032742  Iec3  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF14612  Ino80_Iec3  
Amino Acid Sequences MDDSPSKAEDGVAERRSSGYKSWKKKYRKMRIRFDQKMQQGEELHKQEDKASATVKRLAVENDRLLDLLLEVNNSPQMPAEKRIDVRRGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.28
4 0.27
5 0.27
6 0.3
7 0.36
8 0.46
9 0.56
10 0.64
11 0.71
12 0.78
13 0.84
14 0.84
15 0.86
16 0.86
17 0.87
18 0.88
19 0.9
20 0.88
21 0.84
22 0.81
23 0.75
24 0.7
25 0.6
26 0.52
27 0.43
28 0.39
29 0.39
30 0.32
31 0.28
32 0.23
33 0.22
34 0.2
35 0.22
36 0.2
37 0.15
38 0.16
39 0.17
40 0.19
41 0.23
42 0.23
43 0.21
44 0.2
45 0.21
46 0.23
47 0.25
48 0.25
49 0.22
50 0.21
51 0.21
52 0.19
53 0.17
54 0.13
55 0.1
56 0.08
57 0.07
58 0.07
59 0.08
60 0.1
61 0.1
62 0.1
63 0.1
64 0.15
65 0.17
66 0.23
67 0.27
68 0.32
69 0.37
70 0.45