Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8MRX2

Protein Details
Accession B8MRX2    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
295-316LLIQRIRKRSTSKTKMVQLPYSHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 10, nucl 7, cyto 6, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences MTDLEKYEQLFDENPMEGSSPLRLIIESNDVATLHSYIKKYPERVFIREAMAYYNPLFVATADDRLDVLRVLLDLADSNGVQLQLDGPWDTSLLDVACEGAQLHTVKFFALLSVAYSLRSDLCYSPDPSTGGRKIWLQDEIARSEEILCMLLDRGASVRDAVRSYKFPDVEQDEKPMSLTATALGRAVSRASYKLASRLIAEGADVHARQYGWGGHPVTAVREVTALHVASGYWNVQGIKALLDNCGEVKPADMVSMRDTAGRIPLHWAAENICFDDYYLTDDEIASQICDTLELLIQRIRKRSTSKTKMVQLPYSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.18
4 0.16
5 0.16
6 0.14
7 0.12
8 0.12
9 0.12
10 0.11
11 0.11
12 0.13
13 0.18
14 0.16
15 0.16
16 0.17
17 0.16
18 0.17
19 0.17
20 0.16
21 0.13
22 0.17
23 0.18
24 0.19
25 0.28
26 0.34
27 0.38
28 0.42
29 0.49
30 0.51
31 0.55
32 0.57
33 0.52
34 0.49
35 0.45
36 0.4
37 0.33
38 0.28
39 0.26
40 0.21
41 0.19
42 0.15
43 0.14
44 0.13
45 0.1
46 0.15
47 0.13
48 0.16
49 0.15
50 0.16
51 0.15
52 0.16
53 0.16
54 0.1
55 0.09
56 0.06
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.06
69 0.06
70 0.06
71 0.06
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.05
83 0.06
84 0.05
85 0.05
86 0.06
87 0.05
88 0.08
89 0.08
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.09
96 0.06
97 0.06
98 0.06
99 0.05
100 0.07
101 0.08
102 0.07
103 0.08
104 0.08
105 0.08
106 0.09
107 0.09
108 0.08
109 0.12
110 0.14
111 0.17
112 0.18
113 0.19
114 0.19
115 0.19
116 0.24
117 0.22
118 0.2
119 0.19
120 0.2
121 0.2
122 0.2
123 0.2
124 0.16
125 0.18
126 0.2
127 0.2
128 0.2
129 0.18
130 0.16
131 0.15
132 0.14
133 0.1
134 0.08
135 0.06
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.06
146 0.07
147 0.08
148 0.1
149 0.11
150 0.12
151 0.16
152 0.19
153 0.19
154 0.18
155 0.22
156 0.27
157 0.29
158 0.28
159 0.28
160 0.24
161 0.24
162 0.24
163 0.19
164 0.13
165 0.1
166 0.09
167 0.06
168 0.06
169 0.07
170 0.07
171 0.07
172 0.07
173 0.07
174 0.07
175 0.07
176 0.07
177 0.08
178 0.09
179 0.11
180 0.12
181 0.15
182 0.17
183 0.16
184 0.16
185 0.16
186 0.15
187 0.13
188 0.12
189 0.09
190 0.08
191 0.1
192 0.09
193 0.08
194 0.09
195 0.09
196 0.09
197 0.1
198 0.11
199 0.1
200 0.16
201 0.16
202 0.15
203 0.17
204 0.17
205 0.17
206 0.18
207 0.16
208 0.11
209 0.11
210 0.1
211 0.11
212 0.13
213 0.12
214 0.09
215 0.09
216 0.09
217 0.09
218 0.1
219 0.09
220 0.06
221 0.08
222 0.08
223 0.09
224 0.1
225 0.1
226 0.09
227 0.11
228 0.11
229 0.11
230 0.11
231 0.12
232 0.12
233 0.12
234 0.11
235 0.09
236 0.1
237 0.1
238 0.09
239 0.11
240 0.11
241 0.12
242 0.13
243 0.15
244 0.15
245 0.15
246 0.15
247 0.14
248 0.19
249 0.18
250 0.16
251 0.19
252 0.22
253 0.23
254 0.23
255 0.24
256 0.2
257 0.24
258 0.25
259 0.21
260 0.19
261 0.16
262 0.15
263 0.16
264 0.14
265 0.13
266 0.14
267 0.12
268 0.12
269 0.12
270 0.13
271 0.13
272 0.13
273 0.1
274 0.08
275 0.09
276 0.08
277 0.09
278 0.08
279 0.07
280 0.1
281 0.1
282 0.12
283 0.15
284 0.21
285 0.25
286 0.32
287 0.35
288 0.39
289 0.46
290 0.55
291 0.63
292 0.67
293 0.72
294 0.75
295 0.8
296 0.82
297 0.82
298 0.77