Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YFD8

Protein Details
Accession A0A2C5YFD8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-97WEKLAKCKEQQKPTKSNPKLNKCIDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 25
Family & Domain DBs
Amino Acid Sequences MKASAILLSVFLGFAAAVPVNEQAPGTVGGPQSQQGGPQAINRRGLKAGFPKIASRQTGADNSSEADCEKLYWEKLAKCKEQQKPTKSNPKLNKCIDEFMPKVYACLDGKRQSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.06
3 0.05
4 0.05
5 0.06
6 0.07
7 0.07
8 0.08
9 0.08
10 0.06
11 0.07
12 0.09
13 0.08
14 0.1
15 0.1
16 0.11
17 0.12
18 0.13
19 0.14
20 0.13
21 0.13
22 0.12
23 0.14
24 0.13
25 0.18
26 0.25
27 0.26
28 0.33
29 0.32
30 0.33
31 0.32
32 0.32
33 0.31
34 0.3
35 0.32
36 0.27
37 0.28
38 0.28
39 0.31
40 0.34
41 0.31
42 0.25
43 0.21
44 0.21
45 0.22
46 0.21
47 0.17
48 0.14
49 0.14
50 0.12
51 0.11
52 0.09
53 0.08
54 0.06
55 0.06
56 0.08
57 0.09
58 0.09
59 0.12
60 0.16
61 0.19
62 0.26
63 0.32
64 0.36
65 0.41
66 0.5
67 0.56
68 0.63
69 0.69
70 0.71
71 0.74
72 0.79
73 0.83
74 0.81
75 0.82
76 0.82
77 0.83
78 0.83
79 0.8
80 0.77
81 0.7
82 0.67
83 0.61
84 0.59
85 0.5
86 0.44
87 0.42
88 0.35
89 0.32
90 0.28
91 0.29
92 0.23
93 0.28
94 0.32