FuNGI

A0A2C6AEV9

Protein Details

Accession

A0A2C6AEV9

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
341-360	LEAKRKRLFPRPPRPDHAEL	Basic

NLS Segment(s)

Subcellular Location(s)

mito 19, cyto 6

Family & Domain DBs

InterPro	View protein in InterPro IPR002562 3'-5'_exonuclease_dom IPR012337 RNaseH-like_sf IPR036397 RNaseH_sf
Gene Ontology	GO:0008408 F:3'-5' exonuclease activity GO:0003676 F:nucleic acid binding GO:0006139 P:nucleobase-containing compound metabolic process
Pfam	View protein in Pfam PF01612 DNA_pol_A_exo1
CDD	cd06141 WRN_exo

Amino Acid Sequences

MASKKIVSLWNPSLGIRFSSSLKSACPQLDVGRSVHTTAGSGYGHHDRGDESTVSTESGLTIEAAALNEAPFIRNGSYREPHDDSQVVETSDEKAHVPEDKAKDQQLVAPIFTMSSQLFDAAKAAPAGTAESFWSHTLYESTGDGGVKDKVKVYYCTNAQTMESLCKTHFLGQKILGFDLEWSPFVVLGSTSPRTNLSLIQLASPSSIALFHVAVFAGDYADEGFIAPTFRDIMGDPDVSKVGVNILGDCTRLRKHLGVETRGVFELSHLHNLIDKVSTGGYGRVGKSVVSLATQVEEHLGLPLYKGEVVRRSNWLQRLTQKQIGYSAADAYAGIQLYYALEAKRKRLFPRPPRPDHAELGLPIRTALTNDEDGTQKRSRAAKAPAAVEVPSGSEHTAPAPAELASAEPWVPPPPAHLPAADTRDARVVEADLMARQYRRAKSTPVAGGWSRLVAYYLWHTNRDLDPEAIAKLMRSPPLQKHSVITYILAALVTEELPYDKARLRNEVMSFLHPTALTGKIRSLAKDCEFIKS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.35
2	0.34
3	0.28
4	0.25
5	0.22
6	0.25
7	0.27
8	0.25
9	0.26
10	0.27
11	0.29
12	0.28
13	0.28
14	0.27
15	0.29
16	0.34
17	0.34
18	0.32
19	0.32
20	0.32
21	0.3
22	0.29
23	0.24
24	0.18
25	0.16
26	0.19
27	0.15
28	0.14
29	0.18
30	0.22
31	0.23
32	0.23
33	0.23
34	0.2
35	0.22
36	0.26
37	0.22
38	0.17
39	0.18
40	0.19
41	0.18
42	0.18
43	0.15
44	0.11
45	0.1
46	0.09
47	0.07
48	0.06
49	0.06
50	0.07
51	0.07
52	0.07
53	0.07
54	0.07
55	0.08
56	0.08
57	0.08
58	0.08
59	0.1
60	0.11
61	0.14
62	0.17
63	0.24
64	0.29
65	0.32
66	0.39
67	0.43
68	0.43
69	0.44
70	0.43
71	0.37
72	0.36
73	0.35
74	0.27
75	0.22
76	0.22
77	0.19
78	0.19
79	0.18
80	0.14
81	0.12
82	0.14
83	0.17
84	0.2
85	0.25
86	0.3
87	0.34
88	0.38
89	0.39
90	0.4
91	0.36
92	0.37
93	0.36
94	0.31
95	0.26
96	0.22
97	0.2
98	0.18
99	0.17
100	0.16
101	0.09
102	0.09
103	0.09
104	0.1
105	0.1
106	0.1
107	0.11
108	0.1
109	0.11
110	0.09
111	0.09
112	0.08
113	0.08
114	0.09
115	0.08
116	0.08
117	0.08
118	0.09
119	0.1
120	0.11
121	0.11
122	0.1
123	0.1
124	0.11
125	0.11
126	0.11
127	0.1
128	0.1
129	0.11
130	0.1
131	0.1
132	0.11
133	0.13
134	0.14
135	0.14
136	0.16
137	0.18
138	0.21
139	0.24
140	0.26
141	0.3
142	0.31
143	0.34
144	0.33
145	0.3
146	0.27
147	0.26
148	0.24
149	0.21
150	0.2
151	0.17
152	0.16
153	0.17
154	0.18
155	0.23
156	0.26
157	0.24
158	0.26
159	0.29
160	0.32
161	0.32
162	0.31
163	0.23
164	0.19
165	0.17
166	0.16
167	0.13
168	0.1
169	0.09
170	0.09
171	0.09
172	0.08
173	0.08
174	0.05
175	0.06
176	0.1
177	0.11
178	0.11
179	0.12
180	0.13
181	0.14
182	0.15
183	0.15
184	0.14
185	0.16
186	0.17
187	0.17
188	0.16
189	0.15
190	0.14
191	0.13
192	0.1
193	0.05
194	0.05
195	0.05
196	0.05
197	0.05
198	0.05
199	0.05
200	0.05
201	0.05
202	0.05
203	0.05
204	0.04
205	0.03
206	0.03
207	0.03
208	0.03
209	0.03
210	0.03
211	0.03
212	0.04
213	0.04
214	0.04
215	0.04
216	0.05
217	0.05
218	0.06
219	0.06
220	0.09
221	0.11
222	0.11
223	0.11
224	0.11
225	0.11
226	0.11
227	0.1
228	0.07
229	0.06
230	0.06
231	0.06
232	0.05
233	0.07
234	0.07
235	0.08
236	0.08
237	0.1
238	0.1
239	0.11
240	0.13
241	0.13
242	0.15
243	0.21
244	0.26
245	0.27
246	0.29
247	0.29
248	0.28
249	0.26
250	0.25
251	0.18
252	0.13
253	0.15
254	0.12
255	0.13
256	0.12
257	0.12
258	0.13
259	0.14
260	0.14
261	0.1
262	0.09
263	0.07
264	0.07
265	0.07
266	0.06
267	0.06
268	0.08
269	0.1
270	0.1
271	0.11
272	0.11
273	0.1
274	0.11
275	0.11
276	0.09
277	0.07
278	0.07
279	0.06
280	0.07
281	0.07
282	0.06
283	0.06
284	0.06
285	0.05
286	0.05
287	0.06
288	0.05
289	0.05
290	0.05
291	0.05
292	0.06
293	0.07
294	0.09
295	0.14
296	0.17
297	0.19
298	0.24
299	0.27
300	0.31
301	0.36
302	0.37
303	0.35
304	0.4
305	0.46
306	0.48
307	0.5
308	0.45
309	0.4
310	0.39
311	0.36
312	0.3
313	0.22
314	0.17
315	0.11
316	0.1
317	0.09
318	0.08
319	0.08
320	0.06
321	0.06
322	0.05
323	0.05
324	0.05
325	0.06
326	0.07
327	0.06
328	0.11
329	0.13
330	0.18
331	0.24
332	0.29
333	0.33
334	0.42
335	0.52
336	0.59
337	0.69
338	0.74
339	0.75
340	0.78
341	0.81
342	0.75
343	0.67
344	0.59
345	0.5
346	0.4
347	0.36
348	0.3
349	0.22
350	0.17
351	0.15
352	0.12
353	0.1
354	0.11
355	0.11
356	0.11
357	0.12
358	0.14
359	0.16
360	0.17
361	0.22
362	0.23
363	0.21
364	0.25
365	0.29
366	0.31
367	0.36
368	0.41
369	0.42
370	0.44
371	0.44
372	0.41
373	0.37
374	0.34
375	0.27
376	0.21
377	0.15
378	0.11
379	0.11
380	0.09
381	0.08
382	0.08
383	0.09
384	0.11
385	0.1
386	0.1
387	0.1
388	0.09
389	0.09
390	0.09
391	0.09
392	0.07
393	0.08
394	0.08
395	0.07
396	0.09
397	0.1
398	0.11
399	0.1
400	0.14
401	0.19
402	0.22
403	0.23
404	0.22
405	0.23
406	0.28
407	0.33
408	0.32
409	0.27
410	0.25
411	0.29
412	0.28
413	0.25
414	0.2
415	0.17
416	0.14
417	0.14
418	0.14
419	0.1
420	0.12
421	0.14
422	0.13
423	0.17
424	0.24
425	0.27
426	0.33
427	0.35
428	0.39
429	0.42
430	0.5
431	0.51
432	0.45
433	0.46
434	0.41
435	0.41
436	0.36
437	0.31
438	0.23
439	0.18
440	0.17
441	0.11
442	0.13
443	0.15
444	0.22
445	0.24
446	0.26
447	0.27
448	0.3
449	0.32
450	0.35
451	0.33
452	0.26
453	0.25
454	0.25
455	0.25
456	0.21
457	0.19
458	0.14
459	0.16
460	0.19
461	0.22
462	0.24
463	0.3
464	0.37
465	0.44
466	0.48
467	0.44
468	0.44
469	0.44
470	0.45
471	0.39
472	0.31
473	0.25
474	0.22
475	0.21
476	0.17
477	0.13
478	0.09
479	0.09
480	0.08
481	0.06
482	0.06
483	0.07
484	0.08
485	0.1
486	0.13
487	0.17
488	0.22
489	0.26
490	0.33
491	0.37
492	0.42
493	0.43
494	0.47
495	0.45
496	0.43
497	0.44
498	0.38
499	0.36
500	0.28
501	0.27
502	0.23
503	0.26
504	0.25
505	0.22
506	0.23
507	0.27
508	0.29
509	0.32
510	0.34
511	0.36
512	0.37
513	0.44

A0A2C6AEV9

3D AlphaFold-predicted Structure Viewer