Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZAJ3

Protein Details
Accession A0A2C5ZAJ3   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
32-56SSPASGSRAKRRERRQPRTRASMPTHydrophilic
NLS Segment(s)
PositionSequence
38-49SRAKRRERRQPR
Subcellular Location(s) mito 19, nucl 4.5, cyto_nucl 4, cyto 2.5
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MAARCSVPPSPLAPAAAYSCRPRRVVAGASASSPASGSRAKRRERRQPRTRASMPTCSSTNQSRYRAAAARGSCGSSVAWKATATMASSSDSVEADEREPESEQSESWRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.24
4 0.24
5 0.27
6 0.31
7 0.35
8 0.35
9 0.35
10 0.35
11 0.37
12 0.38
13 0.36
14 0.36
15 0.32
16 0.31
17 0.31
18 0.27
19 0.22
20 0.18
21 0.13
22 0.09
23 0.12
24 0.15
25 0.23
26 0.31
27 0.39
28 0.48
29 0.57
30 0.66
31 0.74
32 0.82
33 0.82
34 0.85
35 0.85
36 0.85
37 0.8
38 0.78
39 0.71
40 0.68
41 0.6
42 0.52
43 0.46
44 0.37
45 0.36
46 0.31
47 0.34
48 0.31
49 0.33
50 0.31
51 0.32
52 0.34
53 0.34
54 0.32
55 0.31
56 0.25
57 0.25
58 0.24
59 0.24
60 0.2
61 0.18
62 0.16
63 0.13
64 0.14
65 0.11
66 0.11
67 0.1
68 0.11
69 0.12
70 0.13
71 0.12
72 0.11
73 0.11
74 0.12
75 0.12
76 0.12
77 0.12
78 0.11
79 0.1
80 0.11
81 0.11
82 0.1
83 0.12
84 0.13
85 0.14
86 0.15
87 0.15
88 0.17
89 0.16
90 0.16
91 0.22