Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5YYU4

Protein Details
Accession A0A2C5YYU4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
79-109EEMGLTSRDRDRRRRKRRRNTRLDNRIAQEKBasic
NLS Segment(s)
PositionSequence
88-98RDRRRRKRRRN
Subcellular Location(s) plas 21, mito 3, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004853  Sugar_P_trans_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF03151  TPT  
Amino Acid Sequences MEPVVGHRRRKSSLINPVGAHLPAHANAHAHAHAHRARLSITIPHESRDEDAASARAGDFAKPESSRDSFSDQDAHDDEEMGLTSRDRDRRRRKRRRNTRLDNRIAQEKDVSPDEMKEADQDVMRRLLVNGLFILLWYMFSLSISLYNKWMFDQNRLNFAFPLFTTSMHMLVQFVLAGLVLYFVPSLRPHAHSSDGGRSRHETEPNNSTGMSKMFYLTRIGPCGAATGLDIGLGNASLKFISLTFYTMCKSSSLAFVLLFAFLFRLETPTWRLVTIIAIMTMGVILMVFGEVQFKLGGFVLVISAAFFSGFRWGLTQILLLRNPATSNPFSSIFFLSPVIGAPSRRRSSCSSPAASPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.67
3 0.6
4 0.59
5 0.56
6 0.47
7 0.37
8 0.27
9 0.21
10 0.18
11 0.19
12 0.18
13 0.16
14 0.17
15 0.21
16 0.2
17 0.19
18 0.18
19 0.24
20 0.26
21 0.29
22 0.3
23 0.28
24 0.27
25 0.28
26 0.29
27 0.27
28 0.29
29 0.34
30 0.32
31 0.32
32 0.33
33 0.32
34 0.32
35 0.28
36 0.25
37 0.17
38 0.18
39 0.17
40 0.16
41 0.15
42 0.13
43 0.13
44 0.13
45 0.12
46 0.12
47 0.14
48 0.19
49 0.18
50 0.2
51 0.23
52 0.24
53 0.27
54 0.29
55 0.32
56 0.28
57 0.29
58 0.33
59 0.28
60 0.3
61 0.28
62 0.27
63 0.22
64 0.22
65 0.19
66 0.14
67 0.14
68 0.1
69 0.1
70 0.07
71 0.1
72 0.15
73 0.23
74 0.29
75 0.4
76 0.51
77 0.62
78 0.73
79 0.82
80 0.87
81 0.91
82 0.96
83 0.97
84 0.97
85 0.97
86 0.97
87 0.96
88 0.93
89 0.89
90 0.81
91 0.78
92 0.68
93 0.57
94 0.49
95 0.4
96 0.35
97 0.29
98 0.27
99 0.19
100 0.19
101 0.19
102 0.16
103 0.15
104 0.13
105 0.13
106 0.12
107 0.13
108 0.13
109 0.14
110 0.14
111 0.14
112 0.13
113 0.12
114 0.14
115 0.13
116 0.12
117 0.1
118 0.09
119 0.09
120 0.08
121 0.09
122 0.05
123 0.05
124 0.04
125 0.05
126 0.04
127 0.04
128 0.05
129 0.04
130 0.08
131 0.1
132 0.1
133 0.12
134 0.13
135 0.13
136 0.14
137 0.19
138 0.16
139 0.21
140 0.3
141 0.29
142 0.36
143 0.36
144 0.36
145 0.31
146 0.3
147 0.25
148 0.16
149 0.18
150 0.12
151 0.11
152 0.12
153 0.12
154 0.13
155 0.12
156 0.12
157 0.08
158 0.07
159 0.07
160 0.05
161 0.04
162 0.03
163 0.03
164 0.03
165 0.02
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.04
172 0.04
173 0.08
174 0.09
175 0.12
176 0.14
177 0.16
178 0.19
179 0.2
180 0.23
181 0.28
182 0.32
183 0.3
184 0.29
185 0.3
186 0.32
187 0.34
188 0.37
189 0.32
190 0.3
191 0.35
192 0.34
193 0.33
194 0.28
195 0.25
196 0.2
197 0.18
198 0.14
199 0.1
200 0.09
201 0.09
202 0.1
203 0.12
204 0.14
205 0.14
206 0.16
207 0.16
208 0.15
209 0.14
210 0.14
211 0.12
212 0.09
213 0.07
214 0.06
215 0.06
216 0.05
217 0.05
218 0.04
219 0.04
220 0.04
221 0.04
222 0.03
223 0.04
224 0.03
225 0.04
226 0.04
227 0.04
228 0.06
229 0.06
230 0.08
231 0.09
232 0.1
233 0.11
234 0.11
235 0.12
236 0.11
237 0.11
238 0.11
239 0.13
240 0.13
241 0.13
242 0.12
243 0.12
244 0.12
245 0.11
246 0.1
247 0.07
248 0.06
249 0.05
250 0.06
251 0.05
252 0.08
253 0.08
254 0.11
255 0.16
256 0.19
257 0.2
258 0.19
259 0.19
260 0.17
261 0.17
262 0.17
263 0.13
264 0.09
265 0.08
266 0.08
267 0.07
268 0.07
269 0.05
270 0.03
271 0.02
272 0.02
273 0.02
274 0.02
275 0.02
276 0.02
277 0.04
278 0.04
279 0.06
280 0.06
281 0.06
282 0.07
283 0.07
284 0.07
285 0.06
286 0.06
287 0.05
288 0.06
289 0.05
290 0.04
291 0.04
292 0.04
293 0.04
294 0.04
295 0.05
296 0.09
297 0.1
298 0.1
299 0.12
300 0.13
301 0.13
302 0.14
303 0.17
304 0.16
305 0.21
306 0.21
307 0.21
308 0.21
309 0.21
310 0.22
311 0.21
312 0.23
313 0.2
314 0.23
315 0.25
316 0.26
317 0.27
318 0.29
319 0.29
320 0.24
321 0.23
322 0.21
323 0.17
324 0.15
325 0.15
326 0.16
327 0.15
328 0.18
329 0.24
330 0.33
331 0.39
332 0.41
333 0.45
334 0.48
335 0.55
336 0.62
337 0.63
338 0.58
339 0.56