Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8MDM5

Protein Details
Accession B8MDM5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
186-217VRTMGRAERKERIKRNERKMRANERRSRKFGABasic
NLS Segment(s)
PositionSequence
101-140KPLPKPKEPTKWELFARKKGIGKYSSKPGAALAEKERRKK
190-217GRAERKERIKRNERKMRANERRSRKFGA
Subcellular Location(s) nucl 15, cyto_nucl 11.5, mito 6, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MATTIEMMDVDTAKPKNTKLPITVTKENPYTFDLGHLLAQDPNPLVISKSESVNNSLKAVARDGAQVLLNQLLTTCPVTSNAKDGVLLSLPPPNTLLPRYKPLPKPKEPTKWELFARKKGIGKYSSKPGAALAEKERRKKLVYDEASGEWVPRWGFKGANKSGENDWVVEVPDKEWKNEAEGKTNVRTMGRAERKERIKRNERKMRANERRSRKFGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.3
4 0.36
5 0.4
6 0.39
7 0.48
8 0.53
9 0.59
10 0.65
11 0.62
12 0.61
13 0.61
14 0.56
15 0.5
16 0.43
17 0.36
18 0.29
19 0.26
20 0.21
21 0.17
22 0.18
23 0.16
24 0.15
25 0.14
26 0.14
27 0.14
28 0.12
29 0.12
30 0.12
31 0.11
32 0.11
33 0.1
34 0.14
35 0.14
36 0.16
37 0.19
38 0.19
39 0.24
40 0.27
41 0.27
42 0.23
43 0.23
44 0.23
45 0.21
46 0.21
47 0.17
48 0.14
49 0.14
50 0.14
51 0.14
52 0.12
53 0.11
54 0.1
55 0.1
56 0.09
57 0.08
58 0.07
59 0.06
60 0.07
61 0.07
62 0.07
63 0.06
64 0.09
65 0.12
66 0.12
67 0.16
68 0.15
69 0.15
70 0.15
71 0.15
72 0.13
73 0.11
74 0.1
75 0.08
76 0.1
77 0.1
78 0.1
79 0.11
80 0.1
81 0.11
82 0.14
83 0.18
84 0.17
85 0.22
86 0.25
87 0.32
88 0.38
89 0.47
90 0.53
91 0.56
92 0.62
93 0.66
94 0.73
95 0.69
96 0.69
97 0.63
98 0.59
99 0.55
100 0.57
101 0.53
102 0.49
103 0.5
104 0.47
105 0.46
106 0.44
107 0.46
108 0.41
109 0.41
110 0.39
111 0.43
112 0.42
113 0.38
114 0.36
115 0.31
116 0.3
117 0.26
118 0.25
119 0.23
120 0.29
121 0.33
122 0.39
123 0.41
124 0.39
125 0.4
126 0.4
127 0.41
128 0.43
129 0.42
130 0.4
131 0.4
132 0.38
133 0.39
134 0.36
135 0.29
136 0.18
137 0.16
138 0.13
139 0.11
140 0.13
141 0.12
142 0.15
143 0.19
144 0.28
145 0.3
146 0.38
147 0.38
148 0.38
149 0.38
150 0.41
151 0.37
152 0.28
153 0.25
154 0.18
155 0.18
156 0.18
157 0.17
158 0.13
159 0.2
160 0.2
161 0.2
162 0.22
163 0.21
164 0.25
165 0.32
166 0.33
167 0.33
168 0.36
169 0.39
170 0.4
171 0.42
172 0.38
173 0.32
174 0.31
175 0.28
176 0.35
177 0.39
178 0.43
179 0.46
180 0.53
181 0.62
182 0.71
183 0.77
184 0.77
185 0.78
186 0.81
187 0.87
188 0.9
189 0.88
190 0.89
191 0.9
192 0.9
193 0.91
194 0.91
195 0.9
196 0.9
197 0.91