Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8MCK5

Protein Details
Accession B8MCK5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
106-130GMVALKKRDRSAKKKGKAKAKTTKGBasic
NLS Segment(s)
PositionSequence
111-130KKRDRSAKKKGKAKAKTTKG
Subcellular Location(s) nucl 16, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MAPHLSNDEFFASLTNLFTNTTQKTKGSIYLTQKRLPSSFSDQSTPEGSILVRATDGRTQNPNPRDSKDSKVSKKKVAPKVKISTVVSPADLELFFVRYADVCKAGMVALKKRDRSAKKKGKAKAKTTKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.11
5 0.12
6 0.16
7 0.18
8 0.21
9 0.23
10 0.23
11 0.25
12 0.26
13 0.31
14 0.3
15 0.34
16 0.4
17 0.47
18 0.51
19 0.52
20 0.53
21 0.5
22 0.46
23 0.41
24 0.37
25 0.36
26 0.37
27 0.35
28 0.35
29 0.33
30 0.34
31 0.34
32 0.29
33 0.2
34 0.15
35 0.12
36 0.12
37 0.11
38 0.09
39 0.08
40 0.07
41 0.09
42 0.13
43 0.14
44 0.15
45 0.19
46 0.22
47 0.29
48 0.33
49 0.36
50 0.34
51 0.36
52 0.39
53 0.38
54 0.41
55 0.42
56 0.48
57 0.52
58 0.6
59 0.61
60 0.63
61 0.67
62 0.71
63 0.72
64 0.73
65 0.71
66 0.7
67 0.72
68 0.68
69 0.67
70 0.6
71 0.53
72 0.47
73 0.41
74 0.32
75 0.26
76 0.22
77 0.17
78 0.14
79 0.12
80 0.08
81 0.09
82 0.08
83 0.08
84 0.08
85 0.07
86 0.09
87 0.1
88 0.11
89 0.1
90 0.1
91 0.1
92 0.1
93 0.13
94 0.16
95 0.2
96 0.28
97 0.35
98 0.38
99 0.42
100 0.52
101 0.59
102 0.63
103 0.69
104 0.7
105 0.74
106 0.8
107 0.84
108 0.85
109 0.85
110 0.87