Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MGJ8

Protein Details
Accession B8MGJ8   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
133-161QEVIKRDEQNRRKKKLKGGRTLVQLKKQGHydrophilic
NLS Segment(s)
PositionSequence
142-152NRRKKKLKGGR
Subcellular Location(s) nucl 16, mito_nucl 12.333, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019189  Ribosomal_L27/L41_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF09809  MRP-L27  
Amino Acid Sequences MKPSQPLMARLRLTTKQVGRGYYKGNRTGSMGFFLKTSAYIIDPGKLRTYVVPENLDDFKLTPFVTKSFLPTRTKYTTEEVRNGLTISKDRAFNGEDYLDLWENLNPREHDDWSSHWKSKRNNLKAKAEADLQEVIKRDEQNRRKKKLKGGRTLVQLKKQGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.46
4 0.48
5 0.5
6 0.49
7 0.49
8 0.51
9 0.5
10 0.53
11 0.51
12 0.5
13 0.46
14 0.44
15 0.44
16 0.38
17 0.35
18 0.3
19 0.23
20 0.21
21 0.2
22 0.17
23 0.14
24 0.13
25 0.09
26 0.08
27 0.11
28 0.12
29 0.15
30 0.16
31 0.17
32 0.18
33 0.18
34 0.18
35 0.16
36 0.21
37 0.21
38 0.23
39 0.24
40 0.22
41 0.25
42 0.25
43 0.24
44 0.19
45 0.16
46 0.12
47 0.12
48 0.12
49 0.1
50 0.1
51 0.1
52 0.13
53 0.12
54 0.16
55 0.19
56 0.25
57 0.28
58 0.29
59 0.35
60 0.36
61 0.38
62 0.36
63 0.36
64 0.38
65 0.37
66 0.39
67 0.33
68 0.3
69 0.28
70 0.26
71 0.22
72 0.15
73 0.13
74 0.13
75 0.14
76 0.14
77 0.14
78 0.16
79 0.17
80 0.16
81 0.17
82 0.13
83 0.11
84 0.11
85 0.13
86 0.11
87 0.1
88 0.1
89 0.09
90 0.11
91 0.12
92 0.15
93 0.13
94 0.17
95 0.19
96 0.2
97 0.21
98 0.22
99 0.25
100 0.3
101 0.36
102 0.37
103 0.39
104 0.44
105 0.48
106 0.56
107 0.63
108 0.64
109 0.69
110 0.72
111 0.77
112 0.77
113 0.73
114 0.66
115 0.59
116 0.5
117 0.43
118 0.38
119 0.3
120 0.26
121 0.25
122 0.24
123 0.24
124 0.27
125 0.3
126 0.37
127 0.46
128 0.54
129 0.63
130 0.71
131 0.75
132 0.79
133 0.84
134 0.84
135 0.85
136 0.85
137 0.84
138 0.82
139 0.83
140 0.86
141 0.82
142 0.8