Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8LZS8

Protein Details
Accession B8LZS8   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
44-68LRAAYEKEKQKRQKSKKQISHDQGIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
Amino Acid Sequences MKKRISRHTRSSSEAIGEVFTRASKAYEMSINELTITQKELHDLRAAYEKEKQKRQKSKKQISHDQGITREEAQALLQGQVEASQAVTTAPAEPELPVSHPPKTSMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.38
3 0.29
4 0.24
5 0.18
6 0.14
7 0.11
8 0.1
9 0.09
10 0.09
11 0.09
12 0.09
13 0.11
14 0.14
15 0.15
16 0.19
17 0.2
18 0.19
19 0.18
20 0.18
21 0.16
22 0.13
23 0.13
24 0.1
25 0.09
26 0.12
27 0.12
28 0.13
29 0.15
30 0.14
31 0.14
32 0.2
33 0.21
34 0.2
35 0.26
36 0.32
37 0.35
38 0.44
39 0.52
40 0.54
41 0.65
42 0.73
43 0.77
44 0.81
45 0.86
46 0.86
47 0.87
48 0.87
49 0.82
50 0.8
51 0.73
52 0.65
53 0.57
54 0.49
55 0.41
56 0.32
57 0.26
58 0.18
59 0.15
60 0.11
61 0.11
62 0.1
63 0.09
64 0.09
65 0.08
66 0.08
67 0.08
68 0.08
69 0.06
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.07
78 0.08
79 0.08
80 0.08
81 0.11
82 0.12
83 0.14
84 0.19
85 0.22
86 0.25
87 0.26