Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4PBZ9

Protein Details
Accession Q4PBZ9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-33DTKTKSSTSTQKRTTKAKKDPDAPKRPLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005694  C:chromosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006281  P:DNA repair  
KEGG uma:UMAG_10132  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAKADTKTKSSTSTQKRTTKAKKDPDAPKRPLSAYMFFSQDQRERVKNANPEAGFGEVGRLLGAKWKEMSEAEKKPYNDMANRDKARAEAEKAAYNKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.71
4 0.77
5 0.81
6 0.81
7 0.81
8 0.81
9 0.8
10 0.82
11 0.86
12 0.87
13 0.86
14 0.81
15 0.76
16 0.69
17 0.62
18 0.58
19 0.52
20 0.44
21 0.38
22 0.35
23 0.32
24 0.29
25 0.29
26 0.26
27 0.25
28 0.24
29 0.24
30 0.24
31 0.24
32 0.27
33 0.31
34 0.33
35 0.33
36 0.36
37 0.32
38 0.31
39 0.29
40 0.26
41 0.21
42 0.15
43 0.13
44 0.07
45 0.07
46 0.06
47 0.05
48 0.04
49 0.09
50 0.09
51 0.1
52 0.11
53 0.11
54 0.13
55 0.14
56 0.19
57 0.22
58 0.28
59 0.31
60 0.36
61 0.37
62 0.39
63 0.43
64 0.44
65 0.41
66 0.43
67 0.47
68 0.51
69 0.52
70 0.51
71 0.46
72 0.42
73 0.42
74 0.4
75 0.36
76 0.33
77 0.35
78 0.4
79 0.43