Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1E7B6

Protein Details
Accession A0A0D1E7B6   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
158-192HFGFGPHKNKKPYIRSKGRKFEKARGRRASRGFKVBasic
NLS Segment(s)
PositionSequence
160-192GFGPHKNKKPYIRSKGRKFEKARGRRASRGFKV
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG uma:UMAG_10238  -  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
Amino Acid Sequences MGIDIAKKHVKNGQRTAPKSQDPYLLLLVKLYRFLARRTDSRFNKAILRRLYMSKINQPPVSVSRVIYLTKSQGGVAASASETPKTVVVVGTITDDNRVLELPKLSVAALRFTNTARARIEAAGGECLTLDQLATRAPTGSNTVLIRGQKNAREAVKHFGFGPHKNKKPYIRSKGRKFEKARGRRASRGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.72
4 0.74
5 0.73
6 0.69
7 0.63
8 0.6
9 0.51
10 0.5
11 0.46
12 0.4
13 0.33
14 0.29
15 0.28
16 0.21
17 0.21
18 0.18
19 0.18
20 0.18
21 0.2
22 0.27
23 0.3
24 0.35
25 0.42
26 0.51
27 0.52
28 0.57
29 0.58
30 0.52
31 0.55
32 0.55
33 0.55
34 0.48
35 0.48
36 0.44
37 0.44
38 0.46
39 0.43
40 0.42
41 0.43
42 0.46
43 0.47
44 0.45
45 0.42
46 0.41
47 0.38
48 0.37
49 0.29
50 0.23
51 0.19
52 0.2
53 0.2
54 0.18
55 0.16
56 0.14
57 0.15
58 0.14
59 0.12
60 0.13
61 0.12
62 0.11
63 0.1
64 0.08
65 0.07
66 0.08
67 0.08
68 0.07
69 0.06
70 0.07
71 0.07
72 0.06
73 0.07
74 0.05
75 0.05
76 0.06
77 0.06
78 0.07
79 0.07
80 0.06
81 0.07
82 0.07
83 0.06
84 0.06
85 0.06
86 0.05
87 0.06
88 0.07
89 0.06
90 0.07
91 0.07
92 0.07
93 0.08
94 0.08
95 0.1
96 0.1
97 0.1
98 0.11
99 0.11
100 0.19
101 0.18
102 0.21
103 0.19
104 0.2
105 0.21
106 0.2
107 0.21
108 0.14
109 0.14
110 0.12
111 0.11
112 0.1
113 0.08
114 0.07
115 0.07
116 0.05
117 0.04
118 0.03
119 0.04
120 0.05
121 0.05
122 0.06
123 0.06
124 0.07
125 0.08
126 0.12
127 0.12
128 0.15
129 0.15
130 0.16
131 0.19
132 0.22
133 0.22
134 0.24
135 0.28
136 0.28
137 0.31
138 0.35
139 0.34
140 0.36
141 0.37
142 0.41
143 0.38
144 0.35
145 0.33
146 0.34
147 0.37
148 0.4
149 0.48
150 0.5
151 0.55
152 0.61
153 0.68
154 0.7
155 0.75
156 0.79
157 0.8
158 0.81
159 0.84
160 0.88
161 0.92
162 0.92
163 0.91
164 0.87
165 0.86
166 0.86
167 0.85
168 0.85
169 0.85
170 0.84
171 0.83
172 0.85