Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A284R6C3

Protein Details
Accession A0A284R6C3    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
127-154VDRAVRKEVSHRKKRKMAKKLARDAEKQBasic
NLS Segment(s)
PositionSequence
132-149RKEVSHRKKRKMAKKLAR
Subcellular Location(s) mito_nucl 13.333, nucl 13, mito 12.5, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MTPSRTPNLKSFTKSSLSVKSPEMPYEKKFIVVQHLLGKTTARNIAKRLKRDDSESISASWRHDTCKICWDKDTRAEYLLPCDCRQNCYHKACLEVAWNTAGQNKCPFCRGDGMFAVHMSWVAVDLVDRAVRKEVSHRKKRKMAKKLARDAEKQLEKLNSIKSRYSGANDGRPSEAPEVIEID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.48
4 0.45
5 0.43
6 0.42
7 0.43
8 0.41
9 0.43
10 0.44
11 0.4
12 0.39
13 0.42
14 0.39
15 0.35
16 0.35
17 0.32
18 0.33
19 0.31
20 0.31
21 0.33
22 0.33
23 0.32
24 0.3
25 0.29
26 0.22
27 0.23
28 0.27
29 0.23
30 0.24
31 0.29
32 0.38
33 0.44
34 0.51
35 0.54
36 0.55
37 0.54
38 0.57
39 0.59
40 0.55
41 0.53
42 0.47
43 0.41
44 0.36
45 0.35
46 0.3
47 0.27
48 0.21
49 0.19
50 0.24
51 0.26
52 0.25
53 0.34
54 0.37
55 0.33
56 0.37
57 0.39
58 0.37
59 0.43
60 0.44
61 0.35
62 0.33
63 0.33
64 0.29
65 0.3
66 0.29
67 0.23
68 0.2
69 0.25
70 0.23
71 0.25
72 0.27
73 0.29
74 0.33
75 0.35
76 0.38
77 0.34
78 0.36
79 0.33
80 0.32
81 0.28
82 0.21
83 0.18
84 0.15
85 0.14
86 0.12
87 0.16
88 0.15
89 0.13
90 0.18
91 0.19
92 0.19
93 0.21
94 0.21
95 0.18
96 0.24
97 0.24
98 0.23
99 0.23
100 0.25
101 0.23
102 0.23
103 0.21
104 0.14
105 0.13
106 0.08
107 0.06
108 0.04
109 0.04
110 0.03
111 0.03
112 0.04
113 0.05
114 0.07
115 0.07
116 0.08
117 0.11
118 0.11
119 0.12
120 0.22
121 0.31
122 0.41
123 0.52
124 0.6
125 0.67
126 0.76
127 0.85
128 0.86
129 0.86
130 0.87
131 0.87
132 0.88
133 0.89
134 0.89
135 0.86
136 0.8
137 0.76
138 0.75
139 0.7
140 0.6
141 0.55
142 0.48
143 0.43
144 0.43
145 0.45
146 0.41
147 0.39
148 0.4
149 0.37
150 0.39
151 0.39
152 0.4
153 0.4
154 0.4
155 0.45
156 0.45
157 0.46
158 0.45
159 0.43
160 0.42
161 0.37
162 0.32
163 0.24