Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A284R4G0

Protein Details
Accession A0A284R4G0    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
218-242RVAAERRKERLTRQKDEKIKPKTVSBasic
NLS Segment(s)
PositionSequence
208-239RKALRTLQEKRVAAERRKERLTRQKDEKIKPK
Subcellular Location(s) mito 22.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038340  MRP-L47_sf  
IPR010729  Ribosomal_L47_mit  
Gene Ontology GO:0005761  C:mitochondrial ribosome  
GO:1990904  C:ribonucleoprotein complex  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF06984  MRP-L47  
Amino Acid Sequences MFSSFLRAPRRCQGIVFKRTLANVLSENTALQVYDPNAAAATNKSTDEPTPTSTTTQKIETSKTHGLYAFFRRKQGEDLVGEDQYDVLGGLYEEDVVNRSGRAWKASELRLKSFTDLHTLWYVLLREQNLLATQAEEVRRAGIAPRMIQLGMGPKKRECRLSMARIKAVMNERRLAYLGAVQLAEEEKEAELDRAVLKHQITQFNRGRKALRTLQEKRVAAERRKERLTRQKDEKIKPKTVSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.62
3 0.61
4 0.56
5 0.51
6 0.51
7 0.49
8 0.39
9 0.32
10 0.26
11 0.23
12 0.22
13 0.19
14 0.18
15 0.16
16 0.15
17 0.12
18 0.1
19 0.11
20 0.1
21 0.13
22 0.13
23 0.12
24 0.12
25 0.12
26 0.13
27 0.11
28 0.13
29 0.12
30 0.13
31 0.13
32 0.15
33 0.16
34 0.21
35 0.22
36 0.23
37 0.26
38 0.27
39 0.29
40 0.3
41 0.32
42 0.29
43 0.29
44 0.29
45 0.28
46 0.3
47 0.3
48 0.35
49 0.38
50 0.37
51 0.36
52 0.33
53 0.32
54 0.33
55 0.39
56 0.41
57 0.37
58 0.4
59 0.4
60 0.4
61 0.41
62 0.4
63 0.36
64 0.27
65 0.29
66 0.28
67 0.26
68 0.24
69 0.21
70 0.17
71 0.11
72 0.1
73 0.06
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.04
82 0.05
83 0.06
84 0.06
85 0.06
86 0.07
87 0.1
88 0.11
89 0.13
90 0.13
91 0.17
92 0.21
93 0.27
94 0.32
95 0.3
96 0.32
97 0.33
98 0.33
99 0.3
100 0.28
101 0.23
102 0.22
103 0.2
104 0.19
105 0.16
106 0.16
107 0.15
108 0.14
109 0.14
110 0.09
111 0.11
112 0.09
113 0.09
114 0.09
115 0.09
116 0.08
117 0.09
118 0.08
119 0.06
120 0.06
121 0.09
122 0.09
123 0.1
124 0.1
125 0.09
126 0.09
127 0.08
128 0.09
129 0.1
130 0.11
131 0.11
132 0.12
133 0.13
134 0.13
135 0.13
136 0.12
137 0.17
138 0.22
139 0.25
140 0.26
141 0.28
142 0.34
143 0.37
144 0.41
145 0.34
146 0.37
147 0.42
148 0.5
149 0.55
150 0.54
151 0.53
152 0.5
153 0.48
154 0.44
155 0.44
156 0.4
157 0.35
158 0.34
159 0.33
160 0.32
161 0.32
162 0.28
163 0.2
164 0.17
165 0.15
166 0.13
167 0.12
168 0.11
169 0.1
170 0.11
171 0.1
172 0.07
173 0.07
174 0.06
175 0.07
176 0.08
177 0.08
178 0.07
179 0.08
180 0.09
181 0.1
182 0.11
183 0.14
184 0.14
185 0.19
186 0.24
187 0.32
188 0.33
189 0.42
190 0.49
191 0.54
192 0.58
193 0.57
194 0.55
195 0.5
196 0.56
197 0.55
198 0.56
199 0.58
200 0.6
201 0.66
202 0.71
203 0.67
204 0.62
205 0.62
206 0.63
207 0.6
208 0.63
209 0.63
210 0.62
211 0.69
212 0.72
213 0.73
214 0.75
215 0.77
216 0.77
217 0.78
218 0.8
219 0.82
220 0.88
221 0.88
222 0.86
223 0.85