Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MAZ9

Protein Details
Accession B8MAZ9    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-28NTSFLPRRPDQPKKKMSITQTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito_nucl 13.5, mito 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037738  Ecm13-like  
Amino Acid Sequences MAPSLLSNTSFLPRRPDQPKKKMSITQTYYLAHTARSKLSKEAARSDHDLRLLVGHANLLDSLMLDLANAEREQEQWFNNTVRNATKKAQPSHIRWADTIEEESMEDDVSDDDSDMSDDDYSDYDEEEEDDEEKFEDLTAIYTAAAVAKPLRRAASPPALISMNEVASDEEEEEEEAARLTLTRSPSRTQSPPGLTEDLSSDDEEDSMPPSPEQLTMDAFASTSGKKQPATQTNLLSETESQSLHNDSCLLILKTKVLLLYDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.51
3 0.6
4 0.65
5 0.72
6 0.8
7 0.79
8 0.83
9 0.81
10 0.79
11 0.78
12 0.73
13 0.68
14 0.64
15 0.57
16 0.51
17 0.47
18 0.39
19 0.31
20 0.3
21 0.27
22 0.28
23 0.31
24 0.32
25 0.32
26 0.39
27 0.42
28 0.42
29 0.47
30 0.45
31 0.46
32 0.49
33 0.49
34 0.46
35 0.42
36 0.38
37 0.29
38 0.26
39 0.22
40 0.18
41 0.14
42 0.11
43 0.09
44 0.09
45 0.08
46 0.07
47 0.06
48 0.05
49 0.05
50 0.04
51 0.04
52 0.03
53 0.04
54 0.04
55 0.06
56 0.05
57 0.06
58 0.07
59 0.08
60 0.11
61 0.13
62 0.13
63 0.14
64 0.18
65 0.18
66 0.21
67 0.21
68 0.21
69 0.24
70 0.28
71 0.29
72 0.29
73 0.34
74 0.39
75 0.41
76 0.49
77 0.5
78 0.52
79 0.58
80 0.6
81 0.56
82 0.48
83 0.47
84 0.39
85 0.33
86 0.29
87 0.18
88 0.13
89 0.12
90 0.12
91 0.09
92 0.07
93 0.05
94 0.04
95 0.04
96 0.05
97 0.05
98 0.04
99 0.04
100 0.04
101 0.05
102 0.05
103 0.05
104 0.04
105 0.04
106 0.04
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.05
117 0.05
118 0.06
119 0.06
120 0.06
121 0.05
122 0.05
123 0.04
124 0.04
125 0.05
126 0.05
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.04
133 0.04
134 0.06
135 0.08
136 0.09
137 0.11
138 0.12
139 0.12
140 0.14
141 0.2
142 0.26
143 0.25
144 0.24
145 0.24
146 0.24
147 0.23
148 0.23
149 0.19
150 0.11
151 0.1
152 0.1
153 0.08
154 0.07
155 0.08
156 0.07
157 0.06
158 0.05
159 0.06
160 0.05
161 0.06
162 0.05
163 0.05
164 0.04
165 0.04
166 0.04
167 0.05
168 0.08
169 0.12
170 0.16
171 0.19
172 0.22
173 0.27
174 0.33
175 0.35
176 0.37
177 0.4
178 0.4
179 0.4
180 0.42
181 0.4
182 0.34
183 0.31
184 0.28
185 0.23
186 0.21
187 0.18
188 0.15
189 0.12
190 0.12
191 0.12
192 0.11
193 0.09
194 0.09
195 0.1
196 0.09
197 0.1
198 0.11
199 0.12
200 0.13
201 0.13
202 0.13
203 0.14
204 0.15
205 0.13
206 0.13
207 0.12
208 0.12
209 0.11
210 0.12
211 0.16
212 0.19
213 0.2
214 0.25
215 0.34
216 0.42
217 0.49
218 0.52
219 0.52
220 0.52
221 0.54
222 0.49
223 0.41
224 0.33
225 0.28
226 0.25
227 0.2
228 0.17
229 0.17
230 0.2
231 0.18
232 0.18
233 0.15
234 0.13
235 0.15
236 0.2
237 0.19
238 0.18
239 0.19
240 0.2
241 0.21
242 0.22
243 0.2