Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A284S4Q3

Protein Details
Accession A0A284S4Q3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-70RWRGRLRGRGKSSHKKRTSHBasic
NLS Segment(s)
PositionSequence
53-67RGRLRGRGKSSHKKR
Subcellular Location(s) mito 14, cyto 9, extr 2
Family & Domain DBs
Amino Acid Sequences MDQRDLNVVPAWCLRGACVVRVAAWLIRVAVRGQPAWCGCVAAWSRGCVVRWRGRLRGRGKSSHKKRTSHHSMIFEYSVQKSTKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.2
4 0.19
5 0.2
6 0.19
7 0.18
8 0.19
9 0.19
10 0.12
11 0.12
12 0.11
13 0.09
14 0.09
15 0.1
16 0.09
17 0.1
18 0.11
19 0.12
20 0.12
21 0.15
22 0.15
23 0.15
24 0.14
25 0.13
26 0.11
27 0.16
28 0.16
29 0.15
30 0.15
31 0.15
32 0.16
33 0.17
34 0.18
35 0.16
36 0.22
37 0.26
38 0.33
39 0.37
40 0.44
41 0.49
42 0.57
43 0.6
44 0.64
45 0.62
46 0.64
47 0.7
48 0.73
49 0.77
50 0.8
51 0.8
52 0.77
53 0.76
54 0.77
55 0.78
56 0.76
57 0.73
58 0.69
59 0.65
60 0.62
61 0.59
62 0.5
63 0.43
64 0.36
65 0.33