Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A284RLJ7

Protein Details
Accession A0A284RLJ7    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
105-128YSINIRPKAPKKVNDKPAGRKGKGHydrophilic
NLS Segment(s)
PositionSequence
110-134RPKAPKKVNDKPAGRKGKGRSGSKA
Subcellular Location(s) cyto 10.5, cyto_nucl 10.5, nucl 7.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR018982  RQC_domain  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0043138  F:3'-5' DNA helicase activity  
GO:0006281  P:DNA repair  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF09382  RQC  
Amino Acid Sequences MVSCNVTKEARDAIALVRSLERDNVTLDQCRLIFRGAERATLQRFDPSLRGAGSHLTQELVEQLFSKLISLDVFTEVSLPNAAGWHIQYLRMGQGVHAFLRLPTYSINIRPKAPKKVNDKPAGRKGKGRSGSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.19
4 0.17
5 0.18
6 0.18
7 0.2
8 0.19
9 0.15
10 0.18
11 0.2
12 0.21
13 0.23
14 0.22
15 0.23
16 0.22
17 0.22
18 0.2
19 0.18
20 0.17
21 0.14
22 0.23
23 0.21
24 0.23
25 0.23
26 0.27
27 0.28
28 0.28
29 0.27
30 0.2
31 0.2
32 0.19
33 0.19
34 0.16
35 0.16
36 0.15
37 0.15
38 0.12
39 0.13
40 0.13
41 0.12
42 0.1
43 0.09
44 0.08
45 0.08
46 0.09
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.06
62 0.07
63 0.06
64 0.07
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.07
73 0.08
74 0.08
75 0.09
76 0.1
77 0.1
78 0.11
79 0.11
80 0.09
81 0.12
82 0.13
83 0.13
84 0.13
85 0.12
86 0.11
87 0.14
88 0.13
89 0.11
90 0.1
91 0.13
92 0.16
93 0.23
94 0.31
95 0.31
96 0.36
97 0.44
98 0.51
99 0.58
100 0.63
101 0.64
102 0.66
103 0.74
104 0.8
105 0.8
106 0.82
107 0.81
108 0.84
109 0.86
110 0.79
111 0.77
112 0.73
113 0.74
114 0.74