Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A284R869

Protein Details
Accession A0A284R869   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-32IATPLKQRLRMKLKRWKAKLRGYLERHydrophilic
NLS Segment(s)
PositionSequence
14-26RLRMKLKRWKAKL
Subcellular Location(s) mito 22, cyto 2.5, nucl 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MPTNIIIATPLKQRLRMKLKRWKAKLRGYLERPGLVYQAETPSPPESQLVPMPIDSTENVNVVIVDAGSHDLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.56
3 0.62
4 0.66
5 0.69
6 0.78
7 0.81
8 0.85
9 0.86
10 0.84
11 0.84
12 0.84
13 0.81
14 0.8
15 0.74
16 0.72
17 0.64
18 0.56
19 0.47
20 0.38
21 0.31
22 0.21
23 0.17
24 0.11
25 0.1
26 0.09
27 0.08
28 0.1
29 0.11
30 0.11
31 0.11
32 0.11
33 0.1
34 0.13
35 0.15
36 0.15
37 0.14
38 0.14
39 0.14
40 0.13
41 0.14
42 0.12
43 0.13
44 0.13
45 0.13
46 0.13
47 0.12
48 0.12
49 0.11
50 0.1
51 0.06
52 0.05
53 0.05