Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CPF4

Protein Details
Accession A0A2H3CPF4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-28ARCGGNVTKTSRKRRRANESPLPPTTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MCARCGGNVTKTSRKRRRANESPLPPTTQCRLVSDEDEHEEDEEEDEDVDLPPPPKPSSSNRPRPTLNIMKPTVVIPKTDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.83
4 0.86
5 0.87
6 0.88
7 0.87
8 0.86
9 0.83
10 0.76
11 0.7
12 0.6
13 0.54
14 0.46
15 0.42
16 0.33
17 0.29
18 0.29
19 0.27
20 0.29
21 0.27
22 0.26
23 0.22
24 0.21
25 0.19
26 0.16
27 0.14
28 0.11
29 0.1
30 0.08
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.07
38 0.07
39 0.09
40 0.12
41 0.12
42 0.14
43 0.17
44 0.25
45 0.34
46 0.44
47 0.54
48 0.56
49 0.62
50 0.63
51 0.64
52 0.65
53 0.65
54 0.62
55 0.6
56 0.56
57 0.52
58 0.5
59 0.47
60 0.46
61 0.37