Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3B2U6

Protein Details
Accession A0A2H3B2U6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-41GLRTRIRGCRRSKERFVYRRWRRSNCLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, mito 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDISWVGRTSWGTGGLRTRIRGCRRSKERFVYRRWRRSNCLSVFAIYSVNFGASVVVILTVFILFNAIESICYFVLALSSRNMERNTRMREGSYLSTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.32
4 0.33
5 0.37
6 0.4
7 0.48
8 0.53
9 0.56
10 0.61
11 0.67
12 0.74
13 0.77
14 0.78
15 0.81
16 0.81
17 0.82
18 0.82
19 0.84
20 0.85
21 0.85
22 0.81
23 0.77
24 0.77
25 0.78
26 0.69
27 0.64
28 0.54
29 0.45
30 0.39
31 0.33
32 0.26
33 0.16
34 0.14
35 0.08
36 0.07
37 0.06
38 0.05
39 0.05
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.04
56 0.05
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.08
63 0.09
64 0.1
65 0.09
66 0.12
67 0.14
68 0.18
69 0.21
70 0.22
71 0.29
72 0.37
73 0.42
74 0.45
75 0.46
76 0.43
77 0.45
78 0.46