Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3B8Z2

Protein Details
Accession A0A2H3B8Z2    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGLCLSSCRRRRRYSNDSSRPRYQYSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045967  DUF5923  
Pfam View protein in Pfam  
PF19343  DUF5923  
Amino Acid Sequences MGLCLSSCRRRRRYSNDSSRPRYQYSEESPLLGDSVDDSQSTDAIVNVPVNLNKAVEVVAALKNGKYPSQDQVDSFSRWFLQSDILRESRYTRISEQGQQIIHDVHRLCSVLLVFGMEKNGDGRLQDLLFLADTISRPLDYAVEGGETTIEADVHRKGSASPRFGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.88
4 0.89
5 0.88
6 0.87
7 0.82
8 0.75
9 0.68
10 0.61
11 0.59
12 0.55
13 0.56
14 0.48
15 0.43
16 0.4
17 0.36
18 0.31
19 0.22
20 0.15
21 0.08
22 0.09
23 0.08
24 0.08
25 0.08
26 0.08
27 0.08
28 0.09
29 0.07
30 0.06
31 0.06
32 0.07
33 0.07
34 0.07
35 0.08
36 0.08
37 0.1
38 0.1
39 0.1
40 0.09
41 0.09
42 0.08
43 0.07
44 0.07
45 0.07
46 0.08
47 0.09
48 0.09
49 0.08
50 0.11
51 0.12
52 0.12
53 0.13
54 0.14
55 0.17
56 0.22
57 0.23
58 0.21
59 0.26
60 0.28
61 0.27
62 0.25
63 0.21
64 0.16
65 0.16
66 0.16
67 0.11
68 0.13
69 0.13
70 0.15
71 0.18
72 0.18
73 0.18
74 0.18
75 0.2
76 0.19
77 0.2
78 0.2
79 0.18
80 0.22
81 0.25
82 0.3
83 0.31
84 0.3
85 0.28
86 0.27
87 0.27
88 0.22
89 0.2
90 0.18
91 0.15
92 0.12
93 0.13
94 0.13
95 0.12
96 0.12
97 0.12
98 0.08
99 0.08
100 0.08
101 0.07
102 0.07
103 0.08
104 0.06
105 0.06
106 0.07
107 0.08
108 0.07
109 0.07
110 0.08
111 0.1
112 0.1
113 0.1
114 0.1
115 0.1
116 0.09
117 0.09
118 0.08
119 0.07
120 0.07
121 0.08
122 0.09
123 0.08
124 0.08
125 0.09
126 0.09
127 0.09
128 0.09
129 0.08
130 0.08
131 0.08
132 0.08
133 0.07
134 0.07
135 0.07
136 0.07
137 0.06
138 0.05
139 0.08
140 0.1
141 0.12
142 0.12
143 0.12
144 0.14
145 0.24
146 0.32