Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3AKW9

Protein Details
Accession A0A2H3AKW9    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-71GNINQKTKTYKVKKKDRGATSAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, mito_nucl 13.666, nucl 10, cyto_nucl 7.166
Family & Domain DBs
Amino Acid Sequences MYSTFSSTAPPSSSIRMDKQYRFRRIKAIEILNLPPEWDKRSYYLKIFAGNINQKTKTYKVKKKDRGATSAPRWTLNFDLYGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.38
4 0.43
5 0.47
6 0.55
7 0.61
8 0.67
9 0.69
10 0.67
11 0.67
12 0.64
13 0.64
14 0.61
15 0.56
16 0.49
17 0.45
18 0.44
19 0.36
20 0.33
21 0.26
22 0.2
23 0.16
24 0.15
25 0.14
26 0.14
27 0.15
28 0.21
29 0.23
30 0.23
31 0.27
32 0.26
33 0.26
34 0.27
35 0.25
36 0.27
37 0.3
38 0.33
39 0.32
40 0.32
41 0.31
42 0.33
43 0.36
44 0.4
45 0.45
46 0.5
47 0.56
48 0.67
49 0.76
50 0.82
51 0.87
52 0.83
53 0.8
54 0.79
55 0.78
56 0.75
57 0.74
58 0.65
59 0.59
60 0.53
61 0.5
62 0.46
63 0.38