Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3C2V4

Protein Details
Accession A0A2H3C2V4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-24VPVPNLTKKSRGRRVPTVTSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences LPVPVPVPNLTKKSRGRRVPTVTSLDISPRRSVDGDFHTATGKGARVHLCQVPGCGKCFARGEHLKRHVRSIHTYEKPHKCPYPGCGKDFSRHDNLGQHMRVHKDYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.72
4 0.76
5 0.8
6 0.79
7 0.76
8 0.72
9 0.64
10 0.55
11 0.48
12 0.44
13 0.4
14 0.35
15 0.31
16 0.25
17 0.25
18 0.25
19 0.25
20 0.23
21 0.23
22 0.26
23 0.24
24 0.24
25 0.23
26 0.22
27 0.21
28 0.18
29 0.14
30 0.1
31 0.13
32 0.14
33 0.14
34 0.17
35 0.18
36 0.19
37 0.17
38 0.18
39 0.2
40 0.19
41 0.19
42 0.19
43 0.18
44 0.19
45 0.21
46 0.2
47 0.23
48 0.3
49 0.33
50 0.4
51 0.5
52 0.54
53 0.53
54 0.58
55 0.54
56 0.5
57 0.52
58 0.49
59 0.5
60 0.49
61 0.55
62 0.59
63 0.64
64 0.65
65 0.65
66 0.62
67 0.56
68 0.54
69 0.54
70 0.55
71 0.52
72 0.5
73 0.51
74 0.5
75 0.53
76 0.56
77 0.56
78 0.51
79 0.48
80 0.47
81 0.45
82 0.48
83 0.49
84 0.46
85 0.44
86 0.43
87 0.46