Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BMF3

Protein Details
Accession A0A2H3BMF3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-87LAFFHIRRFRLRRRQAREQYIALHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, E.R. 7, mito 6, extr 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGITSDMRDVIATSPLFEVHAPSATWAMDDAVNTSAPSRSKGGCKFSVSKNHLIGAVSIVLFCGLAFFHIRRFRLRRRQAREQYIALPVTVDSGKQGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.14
4 0.13
5 0.14
6 0.11
7 0.12
8 0.11
9 0.12
10 0.13
11 0.11
12 0.11
13 0.09
14 0.09
15 0.08
16 0.08
17 0.08
18 0.08
19 0.08
20 0.08
21 0.09
22 0.1
23 0.1
24 0.12
25 0.13
26 0.14
27 0.2
28 0.25
29 0.3
30 0.31
31 0.34
32 0.36
33 0.39
34 0.47
35 0.45
36 0.45
37 0.4
38 0.37
39 0.34
40 0.31
41 0.26
42 0.17
43 0.13
44 0.08
45 0.07
46 0.06
47 0.05
48 0.05
49 0.04
50 0.03
51 0.03
52 0.04
53 0.06
54 0.06
55 0.13
56 0.19
57 0.2
58 0.28
59 0.36
60 0.45
61 0.55
62 0.65
63 0.69
64 0.74
65 0.83
66 0.86
67 0.88
68 0.84
69 0.77
70 0.69
71 0.64
72 0.56
73 0.44
74 0.34
75 0.24
76 0.21
77 0.18
78 0.14