Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3B116

Protein Details
Accession A0A2H3B116    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-76QSQPRPSRTTPRRPRPPQPPPPAPTHydrophilic
NLS Segment(s)
PositionSequence
28-72KRPTGPRPTARRARDQNRPAPPRTQSQPRPSRTTPRRPRPPQPPP
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MTSTDTPTNASEKQQADRTDDPTATPEKRPTGPRPTARRARDQNRPAPPRTQSQPRPSRTTPRRPRPPQPPPPAPTRTITTKATHPPRPEYATPEASQPAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.41
4 0.43
5 0.44
6 0.41
7 0.38
8 0.33
9 0.3
10 0.33
11 0.29
12 0.29
13 0.29
14 0.29
15 0.34
16 0.4
17 0.43
18 0.47
19 0.54
20 0.59
21 0.63
22 0.68
23 0.72
24 0.7
25 0.73
26 0.73
27 0.71
28 0.72
29 0.71
30 0.71
31 0.71
32 0.72
33 0.65
34 0.6
35 0.56
36 0.51
37 0.49
38 0.5
39 0.47
40 0.52
41 0.59
42 0.58
43 0.63
44 0.61
45 0.67
46 0.66
47 0.7
48 0.71
49 0.73
50 0.79
51 0.79
52 0.85
53 0.86
54 0.88
55 0.87
56 0.86
57 0.84
58 0.77
59 0.77
60 0.72
61 0.64
62 0.57
63 0.51
64 0.47
65 0.43
66 0.43
67 0.38
68 0.4
69 0.47
70 0.52
71 0.55
72 0.53
73 0.55
74 0.58
75 0.62
76 0.58
77 0.55
78 0.54
79 0.53
80 0.49
81 0.46