Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BUM0

Protein Details
Accession A0A2H3BUM0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
76-98GEFSHTRKNNPTKQKMSKESKRRHydrophilic
NLS Segment(s)
PositionSequence
88-98KQKMSKESKRR
Subcellular Location(s) mito 19.5, mito_nucl 11.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020934  Ribosomal_S15/S19_CS  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00203  Ribosomal_S19  
PROSITE View protein in PROSITE  
PS00323  RIBOSOMAL_S19  
Amino Acid Sequences MRPTLSLFKGRSAWKGPYFVAFSNLKEASQRNVAIKTQARACTILPNFVGIRFLVHNGKQYLPVLVTQDMVGHKLGEFSHTRKNNPTKQKMSKESKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.4
4 0.39
5 0.4
6 0.34
7 0.34
8 0.28
9 0.25
10 0.28
11 0.27
12 0.23
13 0.22
14 0.23
15 0.21
16 0.24
17 0.25
18 0.22
19 0.24
20 0.24
21 0.28
22 0.29
23 0.28
24 0.29
25 0.3
26 0.28
27 0.27
28 0.27
29 0.29
30 0.26
31 0.26
32 0.2
33 0.19
34 0.18
35 0.17
36 0.17
37 0.09
38 0.1
39 0.08
40 0.1
41 0.11
42 0.12
43 0.16
44 0.17
45 0.18
46 0.18
47 0.18
48 0.17
49 0.15
50 0.15
51 0.13
52 0.12
53 0.12
54 0.1
55 0.12
56 0.12
57 0.12
58 0.11
59 0.09
60 0.09
61 0.1
62 0.1
63 0.12
64 0.15
65 0.17
66 0.27
67 0.31
68 0.35
69 0.43
70 0.53
71 0.58
72 0.66
73 0.73
74 0.73
75 0.79
76 0.86
77 0.87
78 0.88