Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BTU6

Protein Details
Accession A0A2H3BTU6    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
62-85MVVVPSRRHHRSHRHHRSRSYYSYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 10.5, cyto_nucl 9.333, cyto_mito 7.666
Family & Domain DBs
Amino Acid Sequences MPYVSSYASSYYPGSSRSVYPSYGRSYGMPVQHYYGAPMSYGSPYGYSSSSYYGSSYGSTPMVVVPSRRHHRSHRHHRSRSYYSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.19
4 0.22
5 0.23
6 0.24
7 0.25
8 0.27
9 0.29
10 0.28
11 0.28
12 0.23
13 0.25
14 0.27
15 0.28
16 0.26
17 0.23
18 0.23
19 0.24
20 0.23
21 0.2
22 0.17
23 0.13
24 0.11
25 0.11
26 0.09
27 0.08
28 0.08
29 0.07
30 0.06
31 0.07
32 0.08
33 0.08
34 0.09
35 0.09
36 0.11
37 0.12
38 0.12
39 0.12
40 0.11
41 0.11
42 0.11
43 0.1
44 0.1
45 0.09
46 0.09
47 0.08
48 0.08
49 0.1
50 0.1
51 0.12
52 0.16
53 0.26
54 0.34
55 0.39
56 0.43
57 0.5
58 0.61
59 0.7
60 0.76
61 0.78
62 0.81
63 0.86
64 0.9
65 0.91