Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3BGJ9

Protein Details
Accession A0A2H3BGJ9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
44-68KPVNLFVPSRKQRRRPAPYPLRFGIHydrophilic
NLS Segment(s)
PositionSequence
55-58QRRR
Subcellular Location(s) mito 21, nucl 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MGALCRAIFNFSPSARPLNIAIPRFPSLTTAMSKPAYLEYAPTKPVNLFVPSRKQRRRPAPYPLRFGIRTRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.24
4 0.23
5 0.26
6 0.31
7 0.29
8 0.29
9 0.29
10 0.3
11 0.29
12 0.28
13 0.22
14 0.18
15 0.19
16 0.19
17 0.16
18 0.17
19 0.17
20 0.17
21 0.15
22 0.14
23 0.12
24 0.1
25 0.11
26 0.12
27 0.13
28 0.16
29 0.15
30 0.15
31 0.14
32 0.17
33 0.17
34 0.17
35 0.19
36 0.21
37 0.32
38 0.4
39 0.5
40 0.57
41 0.64
42 0.71
43 0.79
44 0.84
45 0.8
46 0.83
47 0.84
48 0.84
49 0.83
50 0.77
51 0.73
52 0.66