Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K5K9

Protein Details
Accession B6K5K9    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
243-266SQSNNNNKYSKRPHKRSYSSGYNSHydrophilic
292-312ISSPSSPAESSKRRKTWRKRWHydrophilic
NLS Segment(s)
PositionSequence
301-312SSKRRKTWRKRW
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0031499  C:TRAMP complex  
GO:0003723  F:RNA binding  
GO:0008270  F:zinc ion binding  
GO:0043629  P:ncRNA polyadenylation  
GO:0071031  P:nuclear mRNA surveillance of mRNA 3'-end processing  
GO:0071039  P:nuclear polyadenylation-dependent CUT catabolic process  
GO:0071035  P:nuclear polyadenylation-dependent rRNA catabolic process  
GO:0071036  P:nuclear polyadenylation-dependent snoRNA catabolic process  
GO:0071037  P:nuclear polyadenylation-dependent snRNA catabolic process  
GO:0071038  P:nuclear polyadenylation-dependent tRNA catabolic process  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MSTETDQVFTGAGEQLDPFFIDDAAEPNASITVDKENSEEHEVAASETSSVSSSEFDEEEWAEVSKGRYFGSDPKDDIICHNCKGHGHVSRDCTHTLCTTCGAIDDHPPHRCPRTKRCMNCGLLGHIQSKCPEPRNRSRVCRTCNIDTHTSRTCPLIWRYYVETEDTVRVEAGRVKKHCYNCAAEGHFGDDCDLPSRSQYQSNTAFCEANCPTGNDVSNEEFTKKLHQEFKDDSHYRPSSSYSQSNNNNKYSKRPHKRSYSSGYNSYNSDRKRRDNYSPYSDGRDKSLRNRISSPSSPAESSKRRKTWRKRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.11
5 0.1
6 0.08
7 0.08
8 0.08
9 0.08
10 0.1
11 0.12
12 0.12
13 0.11
14 0.11
15 0.12
16 0.11
17 0.11
18 0.1
19 0.14
20 0.15
21 0.16
22 0.17
23 0.17
24 0.21
25 0.26
26 0.25
27 0.19
28 0.19
29 0.19
30 0.18
31 0.18
32 0.14
33 0.09
34 0.08
35 0.09
36 0.07
37 0.07
38 0.07
39 0.08
40 0.09
41 0.1
42 0.1
43 0.1
44 0.11
45 0.12
46 0.12
47 0.12
48 0.11
49 0.09
50 0.11
51 0.13
52 0.13
53 0.14
54 0.13
55 0.14
56 0.16
57 0.23
58 0.28
59 0.3
60 0.29
61 0.31
62 0.32
63 0.31
64 0.32
65 0.32
66 0.29
67 0.27
68 0.27
69 0.26
70 0.25
71 0.29
72 0.33
73 0.33
74 0.36
75 0.38
76 0.42
77 0.45
78 0.47
79 0.44
80 0.37
81 0.31
82 0.29
83 0.26
84 0.21
85 0.18
86 0.16
87 0.15
88 0.15
89 0.14
90 0.12
91 0.16
92 0.2
93 0.24
94 0.26
95 0.28
96 0.3
97 0.35
98 0.42
99 0.44
100 0.49
101 0.56
102 0.62
103 0.67
104 0.72
105 0.75
106 0.7
107 0.66
108 0.57
109 0.51
110 0.44
111 0.4
112 0.35
113 0.27
114 0.25
115 0.21
116 0.24
117 0.23
118 0.28
119 0.32
120 0.36
121 0.46
122 0.54
123 0.61
124 0.65
125 0.71
126 0.72
127 0.7
128 0.71
129 0.66
130 0.62
131 0.6
132 0.56
133 0.53
134 0.46
135 0.46
136 0.41
137 0.36
138 0.31
139 0.27
140 0.23
141 0.21
142 0.22
143 0.22
144 0.2
145 0.21
146 0.23
147 0.24
148 0.23
149 0.2
150 0.18
151 0.15
152 0.15
153 0.13
154 0.11
155 0.09
156 0.08
157 0.08
158 0.11
159 0.15
160 0.2
161 0.21
162 0.25
163 0.31
164 0.34
165 0.38
166 0.38
167 0.38
168 0.35
169 0.39
170 0.36
171 0.32
172 0.29
173 0.27
174 0.22
175 0.18
176 0.16
177 0.11
178 0.1
179 0.11
180 0.11
181 0.09
182 0.1
183 0.14
184 0.14
185 0.18
186 0.19
187 0.23
188 0.29
189 0.31
190 0.33
191 0.32
192 0.32
193 0.27
194 0.32
195 0.26
196 0.23
197 0.23
198 0.2
199 0.2
200 0.21
201 0.23
202 0.18
203 0.2
204 0.18
205 0.2
206 0.19
207 0.19
208 0.17
209 0.17
210 0.23
211 0.23
212 0.26
213 0.32
214 0.32
215 0.38
216 0.42
217 0.47
218 0.51
219 0.5
220 0.46
221 0.48
222 0.47
223 0.41
224 0.38
225 0.37
226 0.33
227 0.36
228 0.41
229 0.36
230 0.43
231 0.51
232 0.6
233 0.62
234 0.62
235 0.62
236 0.57
237 0.63
238 0.65
239 0.67
240 0.68
241 0.73
242 0.75
243 0.8
244 0.87
245 0.86
246 0.84
247 0.83
248 0.78
249 0.77
250 0.72
251 0.63
252 0.58
253 0.55
254 0.54
255 0.48
256 0.52
257 0.5
258 0.55
259 0.61
260 0.65
261 0.7
262 0.72
263 0.76
264 0.74
265 0.75
266 0.69
267 0.69
268 0.67
269 0.58
270 0.55
271 0.53
272 0.49
273 0.51
274 0.59
275 0.56
276 0.56
277 0.59
278 0.59
279 0.61
280 0.6
281 0.58
282 0.54
283 0.51
284 0.48
285 0.48
286 0.51
287 0.52
288 0.58
289 0.62
290 0.65
291 0.72
292 0.81