Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K503

Protein Details
Accession B6K503    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
101-127KISLKEFRRKPKSGRSPPSPRPPKRTABasic
NLS Segment(s)
PositionSequence
106-125EFRRKPKSGRSPPSPRPPKR
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, pero 3
Family & Domain DBs
Amino Acid Sequences MPEPMEDVEGTIPPFDVEHEDSAPYKHRGHDVSWAVCPPKYDGRPDLPTLDNWFREVRRFVRARQIPPPEHAYSAYYFLTGDALARVHRDHQLCEDLENNKISLKEFRRKPKSGRSPPSPRPPKRTATSCSKAFRTPGTRVCLHLRVASKCLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.12
4 0.14
5 0.16
6 0.17
7 0.18
8 0.19
9 0.21
10 0.25
11 0.24
12 0.24
13 0.24
14 0.28
15 0.29
16 0.3
17 0.37
18 0.39
19 0.38
20 0.38
21 0.38
22 0.34
23 0.33
24 0.32
25 0.27
26 0.29
27 0.29
28 0.31
29 0.33
30 0.38
31 0.41
32 0.42
33 0.42
34 0.34
35 0.34
36 0.35
37 0.35
38 0.29
39 0.27
40 0.27
41 0.24
42 0.26
43 0.29
44 0.25
45 0.29
46 0.31
47 0.31
48 0.39
49 0.44
50 0.44
51 0.48
52 0.54
53 0.47
54 0.48
55 0.52
56 0.42
57 0.37
58 0.34
59 0.27
60 0.2
61 0.21
62 0.18
63 0.12
64 0.1
65 0.09
66 0.09
67 0.07
68 0.06
69 0.04
70 0.05
71 0.05
72 0.06
73 0.06
74 0.08
75 0.13
76 0.14
77 0.14
78 0.17
79 0.21
80 0.2
81 0.21
82 0.23
83 0.19
84 0.2
85 0.2
86 0.17
87 0.15
88 0.15
89 0.15
90 0.2
91 0.25
92 0.32
93 0.39
94 0.5
95 0.58
96 0.63
97 0.69
98 0.73
99 0.77
100 0.79
101 0.81
102 0.8
103 0.81
104 0.85
105 0.89
106 0.88
107 0.85
108 0.82
109 0.79
110 0.78
111 0.76
112 0.74
113 0.69
114 0.68
115 0.68
116 0.67
117 0.67
118 0.63
119 0.58
120 0.54
121 0.55
122 0.51
123 0.52
124 0.51
125 0.51
126 0.49
127 0.5
128 0.54
129 0.5
130 0.46
131 0.44
132 0.44
133 0.42