Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K240

Protein Details
Accession B6K240    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
76-96TERRKTSSGKKGKPINRDRFIBasic
NLS Segment(s)
PositionSequence
82-88SSGKKGK
Subcellular Location(s) nucl 15.5, cyto_nucl 14, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR027248  Sm_D2  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0071013  C:catalytic step 2 spliceosome  
GO:0005829  C:cytosol  
GO:0071014  C:post-mRNA release spliceosomal complex  
GO:0071011  C:precatalytic spliceosome  
GO:0000974  C:Prp19 complex  
GO:0005685  C:U1 snRNP  
GO:0005686  C:U2 snRNP  
GO:0071004  C:U2-type prespliceosome  
GO:0005687  C:U4 snRNP  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0005682  C:U5 snRNP  
GO:0036261  P:7-methylguanosine cap hypermethylation  
GO:0000387  P:spliceosomal snRNP assembly  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01720  Sm_D2  
Amino Acid Sequences MADLVNKPKGELTEAELARLEEYEFSSGPLSVLQQAVKNHDQVLINCRNNKKLLARVKAFDRHSNMVLENVKEMWTERRKTSSGKKGKPINRDRFISKMFLRGDGVVLVVRIPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.27
4 0.26
5 0.23
6 0.21
7 0.17
8 0.08
9 0.1
10 0.11
11 0.1
12 0.11
13 0.11
14 0.11
15 0.11
16 0.1
17 0.09
18 0.09
19 0.1
20 0.1
21 0.13
22 0.14
23 0.2
24 0.21
25 0.21
26 0.2
27 0.22
28 0.23
29 0.2
30 0.27
31 0.3
32 0.31
33 0.36
34 0.37
35 0.37
36 0.36
37 0.38
38 0.34
39 0.34
40 0.39
41 0.41
42 0.41
43 0.41
44 0.44
45 0.47
46 0.46
47 0.43
48 0.39
49 0.34
50 0.33
51 0.32
52 0.28
53 0.26
54 0.25
55 0.2
56 0.16
57 0.14
58 0.13
59 0.12
60 0.13
61 0.17
62 0.22
63 0.25
64 0.27
65 0.32
66 0.34
67 0.4
68 0.49
69 0.51
70 0.55
71 0.59
72 0.65
73 0.7
74 0.75
75 0.8
76 0.8
77 0.8
78 0.77
79 0.75
80 0.7
81 0.67
82 0.62
83 0.59
84 0.49
85 0.47
86 0.41
87 0.38
88 0.36
89 0.3
90 0.28
91 0.21
92 0.21
93 0.14
94 0.12