Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K157

Protein Details
Accession B6K157    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
519-538FGPNRYRSTNHKSIKPKEGMHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR011701  MFS  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0015225  F:biotin transmembrane transporter activity  
GO:1901604  F:dethiobiotin transmembrane transporter activity  
GO:0015295  F:solute:proton symporter activity  
GO:1905135  P:biotin import across plasma membrane  
GO:1905136  P:dethiobiotin import across plasma membrane  
Pfam View protein in Pfam  
PF07690  MFS_1  
Amino Acid Sequences MIDETRNRLSLEAYETNVKPDTDKNQGVVSLTEKAIDLEKNNDQEVTPSSLEEEFTHDEMKNLQRIRLLIDLRVIPCLWILYFLSCCIRFSVSLAFTMNTTAGHSLLQTLPGINAHYTSLGLALFYVAYVVFEVPSNLVMTLIDPRIWMARIQVSIGVIGACHAILGSKHSSAQGFVCLRFFLGVAESGLWPGLAYYMSRWYRGEHLGKRIGWYYTAAQIAAAAVSLISAGFQRIDMNGGLYGYQWMFLVWGVITIAQGILVAWWLPAVKSRFSEKKLFSRFVPDFLKRFSPSRTPFLKDADKQLHTRYISGMLYGRKWSWRDLIASLLDLRLWPFIVMYFGVVGVGNGIFGYCTLIVRQINPKFSSISVSLLTAPIWLCDALSIVLVMPLYDRFRNKMSFFCSSCVVIIVGLVVATYAHGVWARYVGLLLIGFGLGPTVPICTSWASEVMSETYGDVGVASALALVSGLGNLGSVLTTYALYSGWSSDPTYRKSNDVCIGLIGISIVSCVIERLLLSFGPNRYRSTNHKSIKPKEGMSMNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.36
4 0.36
5 0.33
6 0.27
7 0.3
8 0.33
9 0.35
10 0.38
11 0.36
12 0.36
13 0.37
14 0.36
15 0.32
16 0.29
17 0.24
18 0.22
19 0.2
20 0.18
21 0.18
22 0.19
23 0.2
24 0.19
25 0.21
26 0.27
27 0.29
28 0.3
29 0.3
30 0.27
31 0.27
32 0.28
33 0.28
34 0.22
35 0.19
36 0.21
37 0.21
38 0.22
39 0.2
40 0.22
41 0.19
42 0.2
43 0.23
44 0.21
45 0.21
46 0.25
47 0.3
48 0.31
49 0.29
50 0.3
51 0.3
52 0.31
53 0.34
54 0.37
55 0.33
56 0.27
57 0.3
58 0.33
59 0.3
60 0.32
61 0.27
62 0.2
63 0.19
64 0.18
65 0.14
66 0.11
67 0.12
68 0.12
69 0.12
70 0.14
71 0.19
72 0.18
73 0.19
74 0.19
75 0.19
76 0.17
77 0.19
78 0.24
79 0.2
80 0.21
81 0.22
82 0.2
83 0.19
84 0.19
85 0.17
86 0.1
87 0.11
88 0.09
89 0.08
90 0.08
91 0.08
92 0.1
93 0.1
94 0.11
95 0.1
96 0.1
97 0.1
98 0.11
99 0.12
100 0.1
101 0.1
102 0.09
103 0.09
104 0.09
105 0.08
106 0.08
107 0.07
108 0.06
109 0.06
110 0.05
111 0.05
112 0.04
113 0.04
114 0.03
115 0.03
116 0.04
117 0.04
118 0.04
119 0.05
120 0.05
121 0.06
122 0.06
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.1
129 0.1
130 0.1
131 0.09
132 0.1
133 0.12
134 0.13
135 0.12
136 0.11
137 0.14
138 0.14
139 0.15
140 0.15
141 0.14
142 0.13
143 0.13
144 0.1
145 0.06
146 0.06
147 0.05
148 0.04
149 0.03
150 0.03
151 0.04
152 0.04
153 0.08
154 0.09
155 0.1
156 0.11
157 0.13
158 0.13
159 0.14
160 0.14
161 0.17
162 0.17
163 0.17
164 0.17
165 0.16
166 0.16
167 0.15
168 0.14
169 0.08
170 0.07
171 0.07
172 0.06
173 0.07
174 0.07
175 0.07
176 0.07
177 0.06
178 0.05
179 0.04
180 0.04
181 0.04
182 0.04
183 0.05
184 0.13
185 0.14
186 0.16
187 0.17
188 0.18
189 0.22
190 0.28
191 0.35
192 0.32
193 0.37
194 0.42
195 0.42
196 0.42
197 0.4
198 0.34
199 0.26
200 0.24
201 0.19
202 0.17
203 0.17
204 0.15
205 0.12
206 0.12
207 0.11
208 0.09
209 0.07
210 0.03
211 0.02
212 0.02
213 0.02
214 0.02
215 0.02
216 0.02
217 0.03
218 0.03
219 0.03
220 0.04
221 0.04
222 0.06
223 0.06
224 0.06
225 0.06
226 0.06
227 0.06
228 0.06
229 0.07
230 0.05
231 0.05
232 0.05
233 0.04
234 0.05
235 0.04
236 0.05
237 0.04
238 0.04
239 0.04
240 0.04
241 0.04
242 0.03
243 0.03
244 0.03
245 0.03
246 0.02
247 0.02
248 0.02
249 0.02
250 0.02
251 0.02
252 0.03
253 0.03
254 0.07
255 0.09
256 0.11
257 0.12
258 0.18
259 0.23
260 0.27
261 0.34
262 0.33
263 0.41
264 0.45
265 0.45
266 0.41
267 0.44
268 0.41
269 0.39
270 0.41
271 0.34
272 0.31
273 0.31
274 0.34
275 0.28
276 0.29
277 0.27
278 0.31
279 0.31
280 0.37
281 0.39
282 0.39
283 0.39
284 0.43
285 0.46
286 0.39
287 0.43
288 0.41
289 0.4
290 0.38
291 0.38
292 0.39
293 0.33
294 0.32
295 0.25
296 0.22
297 0.19
298 0.19
299 0.2
300 0.15
301 0.16
302 0.17
303 0.17
304 0.18
305 0.19
306 0.2
307 0.2
308 0.21
309 0.22
310 0.21
311 0.23
312 0.19
313 0.19
314 0.17
315 0.14
316 0.11
317 0.09
318 0.09
319 0.06
320 0.06
321 0.05
322 0.05
323 0.05
324 0.06
325 0.06
326 0.05
327 0.05
328 0.05
329 0.05
330 0.05
331 0.04
332 0.04
333 0.04
334 0.03
335 0.03
336 0.03
337 0.03
338 0.03
339 0.04
340 0.04
341 0.05
342 0.05
343 0.09
344 0.1
345 0.13
346 0.21
347 0.24
348 0.29
349 0.3
350 0.31
351 0.29
352 0.29
353 0.3
354 0.23
355 0.21
356 0.16
357 0.16
358 0.15
359 0.14
360 0.13
361 0.11
362 0.1
363 0.07
364 0.08
365 0.07
366 0.06
367 0.06
368 0.06
369 0.05
370 0.05
371 0.05
372 0.04
373 0.05
374 0.05
375 0.05
376 0.05
377 0.07
378 0.09
379 0.13
380 0.14
381 0.17
382 0.21
383 0.26
384 0.27
385 0.3
386 0.33
387 0.37
388 0.37
389 0.36
390 0.35
391 0.31
392 0.29
393 0.25
394 0.19
395 0.12
396 0.1
397 0.08
398 0.06
399 0.04
400 0.04
401 0.03
402 0.03
403 0.03
404 0.03
405 0.03
406 0.04
407 0.05
408 0.06
409 0.06
410 0.08
411 0.08
412 0.07
413 0.08
414 0.07
415 0.07
416 0.06
417 0.06
418 0.05
419 0.04
420 0.04
421 0.04
422 0.04
423 0.03
424 0.04
425 0.04
426 0.05
427 0.05
428 0.06
429 0.07
430 0.09
431 0.1
432 0.11
433 0.13
434 0.12
435 0.13
436 0.14
437 0.14
438 0.13
439 0.12
440 0.11
441 0.09
442 0.09
443 0.08
444 0.06
445 0.05
446 0.04
447 0.04
448 0.04
449 0.03
450 0.03
451 0.03
452 0.03
453 0.03
454 0.03
455 0.03
456 0.03
457 0.03
458 0.03
459 0.03
460 0.03
461 0.03
462 0.03
463 0.04
464 0.04
465 0.05
466 0.05
467 0.06
468 0.06
469 0.06
470 0.07
471 0.09
472 0.09
473 0.11
474 0.13
475 0.19
476 0.25
477 0.29
478 0.35
479 0.35
480 0.4
481 0.42
482 0.48
483 0.47
484 0.44
485 0.4
486 0.34
487 0.33
488 0.26
489 0.23
490 0.16
491 0.09
492 0.06
493 0.06
494 0.05
495 0.04
496 0.04
497 0.04
498 0.05
499 0.05
500 0.06
501 0.07
502 0.09
503 0.09
504 0.12
505 0.17
506 0.22
507 0.29
508 0.32
509 0.34
510 0.36
511 0.42
512 0.48
513 0.53
514 0.59
515 0.59
516 0.65
517 0.72
518 0.76
519 0.81
520 0.79
521 0.72
522 0.7