Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CHS6

Protein Details
Accession A0A2H3CHS6   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
52-86AGPSNAKAVEKKRKRREKLKERKKRKLVDNPGSLVBasic
NLS Segment(s)
PositionSequence
58-77KAVEKKRKRREKLKERKKRK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MHQGGDDLEDDFVLDIPEEENDGFHVDDAQDFVSEEEGDSAGQPEDGQRDQAGPSNAKAVEKKRKRREKLKERKKRKLVDNPGSLVAVDSIAGHSTSELANYLSEMQKKTFPDMSAIELEATAVPESAIADTTSWQEPRTLDKLVEFIIKVVPSLRTRLLQKSKATGSPTLLFVTGAALRVVDVTRVLKDKKLRGDKGGEVAKLFAKHFKLAEHVTYLRRTKVGAAVGTPGRIGKLLCETDALTMSALSHIILDVTFRDTKRRSLLDIPETRDECMRTVLGCPQVIKQMKAGKIQVVLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.07
5 0.08
6 0.08
7 0.08
8 0.08
9 0.1
10 0.1
11 0.09
12 0.1
13 0.09
14 0.09
15 0.1
16 0.1
17 0.09
18 0.09
19 0.09
20 0.09
21 0.09
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.09
28 0.08
29 0.08
30 0.07
31 0.09
32 0.13
33 0.13
34 0.14
35 0.13
36 0.15
37 0.16
38 0.21
39 0.23
40 0.21
41 0.21
42 0.25
43 0.25
44 0.27
45 0.31
46 0.35
47 0.42
48 0.5
49 0.61
50 0.66
51 0.76
52 0.83
53 0.89
54 0.92
55 0.92
56 0.93
57 0.94
58 0.94
59 0.94
60 0.95
61 0.94
62 0.92
63 0.91
64 0.91
65 0.91
66 0.89
67 0.85
68 0.77
69 0.68
70 0.58
71 0.48
72 0.37
73 0.26
74 0.15
75 0.09
76 0.06
77 0.05
78 0.05
79 0.05
80 0.05
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.05
88 0.06
89 0.08
90 0.1
91 0.13
92 0.14
93 0.15
94 0.19
95 0.2
96 0.23
97 0.25
98 0.22
99 0.23
100 0.23
101 0.24
102 0.21
103 0.2
104 0.16
105 0.13
106 0.12
107 0.09
108 0.08
109 0.06
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.05
119 0.07
120 0.09
121 0.09
122 0.09
123 0.11
124 0.11
125 0.16
126 0.18
127 0.17
128 0.15
129 0.15
130 0.16
131 0.15
132 0.16
133 0.11
134 0.09
135 0.09
136 0.09
137 0.08
138 0.08
139 0.11
140 0.1
141 0.12
142 0.13
143 0.15
144 0.18
145 0.26
146 0.32
147 0.35
148 0.36
149 0.39
150 0.4
151 0.4
152 0.4
153 0.33
154 0.3
155 0.25
156 0.25
157 0.21
158 0.18
159 0.15
160 0.12
161 0.12
162 0.09
163 0.08
164 0.06
165 0.06
166 0.05
167 0.06
168 0.06
169 0.05
170 0.06
171 0.06
172 0.08
173 0.12
174 0.13
175 0.17
176 0.22
177 0.28
178 0.36
179 0.45
180 0.46
181 0.47
182 0.52
183 0.49
184 0.51
185 0.5
186 0.41
187 0.32
188 0.3
189 0.28
190 0.25
191 0.23
192 0.2
193 0.18
194 0.2
195 0.2
196 0.2
197 0.22
198 0.22
199 0.23
200 0.23
201 0.24
202 0.25
203 0.31
204 0.32
205 0.3
206 0.28
207 0.27
208 0.24
209 0.26
210 0.26
211 0.21
212 0.2
213 0.23
214 0.23
215 0.23
216 0.21
217 0.16
218 0.13
219 0.13
220 0.12
221 0.09
222 0.15
223 0.16
224 0.16
225 0.17
226 0.17
227 0.18
228 0.19
229 0.17
230 0.11
231 0.1
232 0.1
233 0.09
234 0.08
235 0.07
236 0.05
237 0.05
238 0.05
239 0.05
240 0.05
241 0.06
242 0.1
243 0.14
244 0.15
245 0.23
246 0.25
247 0.31
248 0.38
249 0.4
250 0.41
251 0.45
252 0.53
253 0.55
254 0.6
255 0.6
256 0.61
257 0.59
258 0.55
259 0.5
260 0.43
261 0.34
262 0.31
263 0.26
264 0.19
265 0.2
266 0.25
267 0.27
268 0.28
269 0.28
270 0.27
271 0.35
272 0.38
273 0.37
274 0.38
275 0.4
276 0.43
277 0.49
278 0.49
279 0.44