Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BVM9

Protein Details
Accession A0A2H3BVM9   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-36SSTTTRKPRFWHRRDKDRSAGGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MFGTRRRTRDTHHASSTTTRKPRFWHRRDKDRSAGGYKAALTNPNTTHHGRKHAKHELRKMGKDTHVPFMTKVKRTLGIRSTTRRTQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.61
3 0.62
4 0.6
5 0.59
6 0.53
7 0.5
8 0.54
9 0.62
10 0.66
11 0.67
12 0.69
13 0.7
14 0.78
15 0.84
16 0.85
17 0.81
18 0.77
19 0.73
20 0.65
21 0.57
22 0.46
23 0.39
24 0.32
25 0.26
26 0.2
27 0.18
28 0.15
29 0.17
30 0.18
31 0.19
32 0.22
33 0.22
34 0.27
35 0.27
36 0.36
37 0.38
38 0.42
39 0.48
40 0.55
41 0.61
42 0.64
43 0.7
44 0.71
45 0.73
46 0.73
47 0.68
48 0.64
49 0.6
50 0.6
51 0.54
52 0.52
53 0.47
54 0.43
55 0.41
56 0.45
57 0.48
58 0.44
59 0.44
60 0.39
61 0.43
62 0.44
63 0.51
64 0.48
65 0.49
66 0.53
67 0.58
68 0.62