Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CPP8

Protein Details
Accession A0A2H3CPP8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MQTLRRLTPRRSRQFRYFTESSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 11.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043519  NT_sf  
Pfam View protein in Pfam  
PF02410  RsfS  
Amino Acid Sequences MQTLRRLTPRRSRQFRYFTESSRIPWFVNQEAPVPKLQVSGSAPPIPSDAPEPVRELYAKLTPLPHLDTSFLTVEKPKLPSPGPPLPYRLPQGRRRRGGTNPGESLYDMPYGLWNWVVIAQVKEGTENRGAIESVVRVVRKTLLEVKPPLPIPPNLKGRMLNEWAMIDAGDFAVHVLSRAVRERYFLNADKPYYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.8
4 0.75
5 0.68
6 0.66
7 0.6
8 0.54
9 0.51
10 0.46
11 0.38
12 0.36
13 0.36
14 0.31
15 0.33
16 0.31
17 0.3
18 0.32
19 0.32
20 0.3
21 0.27
22 0.24
23 0.22
24 0.2
25 0.19
26 0.2
27 0.22
28 0.25
29 0.27
30 0.26
31 0.25
32 0.26
33 0.22
34 0.19
35 0.17
36 0.17
37 0.16
38 0.18
39 0.2
40 0.19
41 0.2
42 0.2
43 0.18
44 0.17
45 0.18
46 0.17
47 0.16
48 0.17
49 0.17
50 0.18
51 0.21
52 0.19
53 0.17
54 0.17
55 0.16
56 0.18
57 0.18
58 0.16
59 0.13
60 0.13
61 0.14
62 0.16
63 0.18
64 0.16
65 0.19
66 0.19
67 0.23
68 0.3
69 0.35
70 0.35
71 0.33
72 0.37
73 0.36
74 0.38
75 0.37
76 0.37
77 0.37
78 0.43
79 0.53
80 0.57
81 0.6
82 0.61
83 0.62
84 0.59
85 0.62
86 0.59
87 0.54
88 0.46
89 0.41
90 0.38
91 0.33
92 0.3
93 0.21
94 0.15
95 0.09
96 0.08
97 0.08
98 0.07
99 0.07
100 0.07
101 0.05
102 0.05
103 0.06
104 0.07
105 0.07
106 0.07
107 0.07
108 0.09
109 0.09
110 0.11
111 0.1
112 0.12
113 0.13
114 0.13
115 0.13
116 0.12
117 0.13
118 0.11
119 0.11
120 0.09
121 0.09
122 0.11
123 0.11
124 0.1
125 0.11
126 0.14
127 0.14
128 0.17
129 0.24
130 0.26
131 0.32
132 0.36
133 0.36
134 0.38
135 0.38
136 0.37
137 0.32
138 0.32
139 0.32
140 0.37
141 0.43
142 0.41
143 0.43
144 0.44
145 0.44
146 0.46
147 0.44
148 0.37
149 0.31
150 0.28
151 0.26
152 0.22
153 0.19
154 0.12
155 0.08
156 0.07
157 0.05
158 0.04
159 0.04
160 0.05
161 0.05
162 0.05
163 0.06
164 0.07
165 0.1
166 0.16
167 0.2
168 0.2
169 0.22
170 0.24
171 0.29
172 0.35
173 0.36
174 0.37
175 0.4