Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BBK3

Protein Details
Accession A0A2H3BBK3   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-42IHIASKFESGRRKKKNKKSEVVCCVQVHydrophilic
NLS Segment(s)
PositionSequence
21-33KFESGRRKKKNKK
Subcellular Location(s) nucl 10.5, cyto_nucl 8.833, mito 7.5, cyto_mito 7.333, cyto 6
Family & Domain DBs
Amino Acid Sequences MHPSNDQRKVLAKPGIHIASKFESGRRKKKNKKSEVVCCVQVENNRFFRSLAVQAMPSEAGVARGIGSITRLLTSYSVRGIRSEKFARTPGNSPKCLSHNSGFLPRQNLLHFYAETGVLLVSFKRLTKTGILSASFKRLNASTRLCMCCGLTRTRYRAQSDAETTSLPKESRVHTSRVGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.43
4 0.39
5 0.36
6 0.33
7 0.36
8 0.34
9 0.31
10 0.36
11 0.45
12 0.55
13 0.61
14 0.69
15 0.75
16 0.85
17 0.91
18 0.91
19 0.92
20 0.92
21 0.92
22 0.89
23 0.84
24 0.77
25 0.67
26 0.58
27 0.51
28 0.46
29 0.4
30 0.37
31 0.37
32 0.34
33 0.33
34 0.32
35 0.29
36 0.28
37 0.26
38 0.23
39 0.18
40 0.18
41 0.17
42 0.18
43 0.16
44 0.12
45 0.1
46 0.07
47 0.07
48 0.06
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.05
56 0.06
57 0.06
58 0.06
59 0.06
60 0.07
61 0.08
62 0.09
63 0.11
64 0.13
65 0.13
66 0.14
67 0.16
68 0.16
69 0.22
70 0.24
71 0.22
72 0.23
73 0.26
74 0.27
75 0.28
76 0.32
77 0.35
78 0.39
79 0.39
80 0.37
81 0.37
82 0.37
83 0.37
84 0.36
85 0.28
86 0.25
87 0.26
88 0.32
89 0.31
90 0.3
91 0.3
92 0.27
93 0.27
94 0.24
95 0.25
96 0.2
97 0.2
98 0.18
99 0.15
100 0.15
101 0.13
102 0.12
103 0.1
104 0.07
105 0.05
106 0.05
107 0.04
108 0.05
109 0.06
110 0.07
111 0.08
112 0.1
113 0.12
114 0.15
115 0.18
116 0.21
117 0.24
118 0.25
119 0.27
120 0.28
121 0.32
122 0.3
123 0.27
124 0.25
125 0.23
126 0.25
127 0.28
128 0.32
129 0.31
130 0.38
131 0.4
132 0.39
133 0.38
134 0.36
135 0.35
136 0.34
137 0.34
138 0.34
139 0.39
140 0.44
141 0.51
142 0.56
143 0.55
144 0.56
145 0.54
146 0.55
147 0.52
148 0.5
149 0.44
150 0.38
151 0.35
152 0.32
153 0.32
154 0.24
155 0.23
156 0.24
157 0.26
158 0.35
159 0.37
160 0.4