Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BXL5

Protein Details
Accession A0A2H3BXL5    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-36PKEATKPKRKAAEKAEKAPRKAKKDPKAPKRALSABasic
NLS Segment(s)
PositionSequence
6-32TKPKRKAAEKAEKAPRKAKKDPKAPKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEATKPKRKAAEKAEKAPRKAKKDPKAPKRALSAYMFFSQDWRERIKNENPDAGFGEVGKLLGAKWKELDDEEKKPYVDLAAKDKARAEDEKAAYDGGKKSAAGSGEDEEDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.83
4 0.8
5 0.8
6 0.79
7 0.77
8 0.74
9 0.76
10 0.76
11 0.75
12 0.79
13 0.84
14 0.86
15 0.88
16 0.85
17 0.81
18 0.79
19 0.72
20 0.66
21 0.59
22 0.51
23 0.43
24 0.4
25 0.35
26 0.26
27 0.24
28 0.22
29 0.22
30 0.22
31 0.22
32 0.22
33 0.23
34 0.29
35 0.35
36 0.41
37 0.39
38 0.43
39 0.38
40 0.38
41 0.37
42 0.32
43 0.24
44 0.15
45 0.13
46 0.07
47 0.07
48 0.05
49 0.04
50 0.03
51 0.08
52 0.08
53 0.08
54 0.09
55 0.1
56 0.11
57 0.12
58 0.19
59 0.21
60 0.25
61 0.28
62 0.3
63 0.29
64 0.28
65 0.27
66 0.23
67 0.22
68 0.2
69 0.23
70 0.28
71 0.29
72 0.3
73 0.32
74 0.32
75 0.31
76 0.31
77 0.29
78 0.3
79 0.32
80 0.33
81 0.32
82 0.3
83 0.27
84 0.29
85 0.25
86 0.19
87 0.19
88 0.16
89 0.16
90 0.19
91 0.2
92 0.18
93 0.19
94 0.19
95 0.19