Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3BLH7

Protein Details
Accession A0A2H3BLH7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
29-54PKPTPPQTKASRKVRATRKLRTEPKGHydrophilic
NLS Segment(s)
PositionSequence
39-47SRKVRATRK
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, cyto 6.5, cysk 6
Family & Domain DBs
Amino Acid Sequences MSVLVLEASDMEYLATPKAPNASLPSNFPKPTPPQTKASRKVRATRKLRTEPKGLPLMLWGWPLDENFFVPGSQNHLDCGDDIGEIYCCIHPILREHRLIYRIPIKAVNIKSKPNLVLYFATNQSSSRMKKMVKTEGVERFMEAADVAAPPSWVRTSNFSSERYVDPETLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.09
4 0.1
5 0.14
6 0.14
7 0.15
8 0.2
9 0.25
10 0.25
11 0.31
12 0.37
13 0.4
14 0.41
15 0.39
16 0.4
17 0.41
18 0.49
19 0.52
20 0.49
21 0.51
22 0.6
23 0.7
24 0.74
25 0.77
26 0.76
27 0.73
28 0.79
29 0.81
30 0.81
31 0.79
32 0.78
33 0.78
34 0.79
35 0.82
36 0.78
37 0.75
38 0.68
39 0.66
40 0.62
41 0.52
42 0.41
43 0.34
44 0.3
45 0.23
46 0.21
47 0.15
48 0.1
49 0.1
50 0.1
51 0.1
52 0.09
53 0.08
54 0.08
55 0.08
56 0.07
57 0.07
58 0.08
59 0.12
60 0.13
61 0.13
62 0.13
63 0.13
64 0.13
65 0.12
66 0.13
67 0.08
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.1
80 0.17
81 0.21
82 0.23
83 0.24
84 0.27
85 0.29
86 0.28
87 0.28
88 0.29
89 0.25
90 0.25
91 0.25
92 0.24
93 0.29
94 0.33
95 0.37
96 0.33
97 0.36
98 0.36
99 0.38
100 0.38
101 0.35
102 0.32
103 0.25
104 0.24
105 0.23
106 0.25
107 0.23
108 0.22
109 0.19
110 0.18
111 0.19
112 0.23
113 0.23
114 0.23
115 0.28
116 0.29
117 0.34
118 0.42
119 0.48
120 0.48
121 0.49
122 0.53
123 0.55
124 0.57
125 0.51
126 0.44
127 0.36
128 0.29
129 0.26
130 0.18
131 0.1
132 0.07
133 0.07
134 0.07
135 0.06
136 0.06
137 0.06
138 0.09
139 0.1
140 0.12
141 0.14
142 0.2
143 0.25
144 0.33
145 0.37
146 0.37
147 0.4
148 0.41
149 0.42
150 0.41
151 0.39