Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JV41

Protein Details
Accession B6JV41    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
342-374IDLAYPDPTKKPKKDKKQKKQKTPKTEAAAAKAHydrophilic
NLS Segment(s)
PositionSequence
351-383KKPKKDKKQKKQKTPKTEAAAAKAAAAKAAKAK
Subcellular Location(s) cyto 18.5, cyto_nucl 13.333, nucl 7, mito_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR002305  aa-tRNA-synth_Ic  
IPR014729  Rossmann-like_a/b/a_fold  
IPR002307  Tyr-tRNA-ligase  
IPR023617  Tyr-tRNA-ligase_arc/euk-type  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0004831  F:tyrosine-tRNA ligase activity  
GO:0006437  P:tyrosyl-tRNA aminoacylation  
Pfam View protein in Pfam  
PF00579  tRNA-synt_1b  
CDD cd00805  TyrRS_core  
Amino Acid Sequences MSLSVDEKYELITRSLQEVLGGPALKEILKERNLNLYWGTAPTGRPHCGYFVPMMKLADFLKADVHVKVLLADVHAFLDNMKAPMELVQYRVRYYEAVVKAILVSLNVPIEKLKFVIGSSYQLSKEYTLDNFRLTAITTEHDARRAGAEVVKQVSSPLLSGLLYPGMQALDEQYLEVDAQFGGVDQRKIFVMAEKVLPALGYKKRVHLMNPMVPSLAGGKMSASAAANAKIDLLDEPNVVKKKIRSAFCEPGVVEENGCLAFLKFVSFPAMALRNVDEFVINRPEKFGGKIVYKTYEELENDYRENKLSPQDLKLGLEDSINWLLAPIQEYLKGLPDFVELIDLAYPDPTKKPKKDKKQKKQKTPKTEAAAAKAAAAKAAKAKQASVEQVTKEVANAQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.22
4 0.19
5 0.19
6 0.19
7 0.2
8 0.19
9 0.16
10 0.15
11 0.17
12 0.16
13 0.16
14 0.17
15 0.21
16 0.26
17 0.3
18 0.31
19 0.39
20 0.4
21 0.41
22 0.38
23 0.32
24 0.28
25 0.26
26 0.27
27 0.19
28 0.2
29 0.25
30 0.3
31 0.3
32 0.3
33 0.3
34 0.31
35 0.3
36 0.31
37 0.29
38 0.3
39 0.3
40 0.31
41 0.31
42 0.28
43 0.29
44 0.27
45 0.26
46 0.2
47 0.17
48 0.16
49 0.17
50 0.19
51 0.17
52 0.17
53 0.13
54 0.13
55 0.13
56 0.12
57 0.1
58 0.1
59 0.1
60 0.09
61 0.1
62 0.1
63 0.09
64 0.08
65 0.1
66 0.11
67 0.11
68 0.11
69 0.09
70 0.09
71 0.12
72 0.16
73 0.14
74 0.17
75 0.22
76 0.23
77 0.23
78 0.24
79 0.23
80 0.19
81 0.2
82 0.26
83 0.21
84 0.22
85 0.21
86 0.2
87 0.19
88 0.19
89 0.17
90 0.09
91 0.07
92 0.07
93 0.08
94 0.08
95 0.08
96 0.08
97 0.09
98 0.1
99 0.1
100 0.1
101 0.09
102 0.09
103 0.12
104 0.12
105 0.14
106 0.15
107 0.18
108 0.17
109 0.18
110 0.19
111 0.16
112 0.17
113 0.16
114 0.17
115 0.18
116 0.19
117 0.19
118 0.18
119 0.17
120 0.16
121 0.15
122 0.13
123 0.1
124 0.1
125 0.11
126 0.15
127 0.15
128 0.16
129 0.16
130 0.15
131 0.15
132 0.15
133 0.14
134 0.13
135 0.14
136 0.15
137 0.16
138 0.16
139 0.15
140 0.13
141 0.13
142 0.11
143 0.09
144 0.07
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.06
153 0.05
154 0.05
155 0.04
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.04
165 0.03
166 0.03
167 0.03
168 0.03
169 0.06
170 0.07
171 0.08
172 0.08
173 0.09
174 0.09
175 0.1
176 0.1
177 0.09
178 0.1
179 0.1
180 0.11
181 0.11
182 0.11
183 0.1
184 0.1
185 0.08
186 0.11
187 0.12
188 0.18
189 0.18
190 0.21
191 0.24
192 0.26
193 0.27
194 0.3
195 0.34
196 0.33
197 0.34
198 0.32
199 0.29
200 0.27
201 0.26
202 0.19
203 0.13
204 0.07
205 0.06
206 0.05
207 0.06
208 0.06
209 0.07
210 0.06
211 0.06
212 0.07
213 0.09
214 0.09
215 0.08
216 0.08
217 0.07
218 0.07
219 0.07
220 0.07
221 0.07
222 0.07
223 0.08
224 0.13
225 0.15
226 0.15
227 0.17
228 0.17
229 0.25
230 0.32
231 0.35
232 0.37
233 0.44
234 0.51
235 0.5
236 0.52
237 0.43
238 0.39
239 0.38
240 0.32
241 0.23
242 0.16
243 0.15
244 0.11
245 0.11
246 0.08
247 0.05
248 0.05
249 0.05
250 0.07
251 0.06
252 0.07
253 0.1
254 0.1
255 0.1
256 0.13
257 0.16
258 0.14
259 0.15
260 0.16
261 0.13
262 0.14
263 0.14
264 0.11
265 0.09
266 0.12
267 0.2
268 0.2
269 0.19
270 0.2
271 0.22
272 0.23
273 0.24
274 0.24
275 0.21
276 0.24
277 0.28
278 0.29
279 0.32
280 0.32
281 0.31
282 0.29
283 0.29
284 0.25
285 0.27
286 0.28
287 0.26
288 0.26
289 0.26
290 0.25
291 0.21
292 0.22
293 0.2
294 0.21
295 0.24
296 0.26
297 0.28
298 0.33
299 0.33
300 0.33
301 0.31
302 0.27
303 0.22
304 0.19
305 0.16
306 0.15
307 0.15
308 0.13
309 0.12
310 0.11
311 0.11
312 0.12
313 0.13
314 0.1
315 0.1
316 0.11
317 0.12
318 0.13
319 0.18
320 0.17
321 0.16
322 0.15
323 0.15
324 0.14
325 0.13
326 0.14
327 0.08
328 0.09
329 0.1
330 0.09
331 0.08
332 0.09
333 0.1
334 0.1
335 0.16
336 0.25
337 0.34
338 0.43
339 0.54
340 0.64
341 0.75
342 0.84
343 0.9
344 0.93
345 0.95
346 0.96
347 0.97
348 0.97
349 0.97
350 0.97
351 0.95
352 0.93
353 0.89
354 0.87
355 0.81
356 0.75
357 0.69
358 0.58
359 0.51
360 0.44
361 0.36
362 0.3
363 0.25
364 0.21
365 0.23
366 0.27
367 0.3
368 0.28
369 0.3
370 0.32
371 0.38
372 0.43
373 0.42
374 0.43
375 0.39
376 0.41
377 0.41
378 0.36
379 0.3