Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3BP42

Protein Details
Accession A0A2H3BP42    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAMWKLRRKTSRKRRKPRLLRLELDRPABasic
NLS Segment(s)
PositionSequence
5-19KLRRKTSRKRRKPRL
Subcellular Location(s) mito_nucl 12.833, mito 12, nucl 11.5, cyto_nucl 7.166
Family & Domain DBs
Amino Acid Sequences MAMWKLRRKTSRKRRKPRLLRLELDRPAFNSASLITTPFTTILPAARSFLLPHNRWERVHSGNVYQSDDPDAPNDHIPLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.94
3 0.96
4 0.96
5 0.96
6 0.94
7 0.89
8 0.85
9 0.83
10 0.77
11 0.69
12 0.58
13 0.48
14 0.42
15 0.35
16 0.27
17 0.18
18 0.14
19 0.12
20 0.12
21 0.11
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.06
28 0.06
29 0.07
30 0.08
31 0.08
32 0.09
33 0.09
34 0.09
35 0.1
36 0.17
37 0.24
38 0.23
39 0.29
40 0.35
41 0.39
42 0.39
43 0.41
44 0.4
45 0.37
46 0.41
47 0.37
48 0.34
49 0.36
50 0.37
51 0.38
52 0.33
53 0.29
54 0.28
55 0.27
56 0.24
57 0.21
58 0.22
59 0.2
60 0.22