Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K1Y7

Protein Details
Accession B6K1Y7    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
33-58SYSVVRKVTDKKTKKNFAVKVIRKDAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16.5, cyto_nucl 14.5, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR017441  Protein_kinase_ATP_BS  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0005516  F:calmodulin binding  
GO:0004683  F:calmodulin-dependent protein kinase activity  
GO:0071277  P:cellular response to calcium ion  
GO:0034599  P:cellular response to oxidative stress  
GO:0106057  P:negative regulation of calcineurin-mediated signaling  
GO:0010972  P:negative regulation of G2/M transition of mitotic cell cycle  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0010621  P:negative regulation of transcription by transcription factor localization  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS00107  PROTEIN_KINASE_ATP  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
CDD cd05117  STKc_CAMK  
Amino Acid Sequences MSSSQNLMDLEVNQSVYDVLQGYDVGDVIGKGSYSVVRKVTDKKTKKNFAVKVIRKDALQDNLKYVQQEIRIMTDVSVGHPNILTLYKAYETDEFFLLLTDLAEGGELYDCVCAKGQFNEAVVKCIIRQLVSAVAYIHKNGIVHRDLKPENVLLECRDDYTNLWIADFGLANILNEESRGVLHTMCGTPGYMAPECIRQLGHAQPVDLWSIGVITYLLIAGFAPFERQTPALEMRAVLKSDYTFPSDVFQNISDECKNFIKSCLVQNPNDRITAEDALRHPFLKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.11
4 0.11
5 0.09
6 0.07
7 0.07
8 0.08
9 0.08
10 0.08
11 0.08
12 0.06
13 0.06
14 0.05
15 0.06
16 0.06
17 0.05
18 0.05
19 0.06
20 0.1
21 0.13
22 0.17
23 0.19
24 0.22
25 0.26
26 0.35
27 0.44
28 0.51
29 0.57
30 0.64
31 0.72
32 0.79
33 0.84
34 0.85
35 0.81
36 0.81
37 0.83
38 0.81
39 0.8
40 0.77
41 0.7
42 0.6
43 0.58
44 0.53
45 0.51
46 0.48
47 0.4
48 0.37
49 0.39
50 0.4
51 0.36
52 0.31
53 0.26
54 0.23
55 0.25
56 0.21
57 0.21
58 0.21
59 0.21
60 0.2
61 0.19
62 0.16
63 0.15
64 0.18
65 0.15
66 0.14
67 0.13
68 0.13
69 0.12
70 0.12
71 0.1
72 0.07
73 0.08
74 0.09
75 0.09
76 0.11
77 0.12
78 0.13
79 0.14
80 0.14
81 0.13
82 0.12
83 0.12
84 0.1
85 0.08
86 0.06
87 0.04
88 0.04
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.04
97 0.05
98 0.05
99 0.06
100 0.06
101 0.07
102 0.09
103 0.11
104 0.12
105 0.13
106 0.19
107 0.18
108 0.2
109 0.19
110 0.17
111 0.15
112 0.16
113 0.15
114 0.09
115 0.09
116 0.08
117 0.1
118 0.11
119 0.11
120 0.09
121 0.1
122 0.1
123 0.11
124 0.1
125 0.08
126 0.08
127 0.08
128 0.12
129 0.12
130 0.15
131 0.16
132 0.22
133 0.22
134 0.23
135 0.24
136 0.2
137 0.19
138 0.17
139 0.16
140 0.11
141 0.13
142 0.12
143 0.13
144 0.12
145 0.12
146 0.12
147 0.14
148 0.18
149 0.14
150 0.14
151 0.13
152 0.13
153 0.13
154 0.12
155 0.09
156 0.05
157 0.06
158 0.05
159 0.06
160 0.06
161 0.05
162 0.05
163 0.05
164 0.04
165 0.04
166 0.05
167 0.06
168 0.05
169 0.06
170 0.08
171 0.08
172 0.08
173 0.08
174 0.08
175 0.07
176 0.09
177 0.12
178 0.11
179 0.12
180 0.12
181 0.15
182 0.16
183 0.16
184 0.15
185 0.12
186 0.15
187 0.18
188 0.23
189 0.2
190 0.2
191 0.19
192 0.21
193 0.21
194 0.17
195 0.13
196 0.07
197 0.07
198 0.06
199 0.06
200 0.05
201 0.03
202 0.03
203 0.04
204 0.03
205 0.03
206 0.03
207 0.03
208 0.04
209 0.04
210 0.06
211 0.07
212 0.08
213 0.1
214 0.11
215 0.12
216 0.16
217 0.2
218 0.19
219 0.2
220 0.2
221 0.21
222 0.23
223 0.23
224 0.18
225 0.16
226 0.16
227 0.19
228 0.21
229 0.21
230 0.19
231 0.19
232 0.21
233 0.22
234 0.22
235 0.2
236 0.19
237 0.17
238 0.17
239 0.21
240 0.21
241 0.2
242 0.23
243 0.25
244 0.27
245 0.26
246 0.28
247 0.31
248 0.32
249 0.4
250 0.46
251 0.47
252 0.5
253 0.58
254 0.63
255 0.58
256 0.57
257 0.48
258 0.4
259 0.4
260 0.39
261 0.32
262 0.29
263 0.29
264 0.32
265 0.34