Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3BAS6

Protein Details
Accession A0A2H3BAS6    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MDANFWLKNRLRHRNKDKKDCPLYLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12cyto_nucl 12, cyto 10, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR040521  KDZ  
Pfam View protein in Pfam  
PF18758  KDZ  
Amino Acid Sequences MDANFWLKNRLRHRNKDKKDCPLYLGLGYQVPNEEYFNHLKNYVNEEDISTCIMFAALMQKDTRLSTGLRCMGVGGCVCLRHELVCPLGLGDLLKGERYVDEPPGSVRSEFADFKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.9
3 0.92
4 0.91
5 0.9
6 0.89
7 0.8
8 0.73
9 0.66
10 0.58
11 0.48
12 0.41
13 0.31
14 0.24
15 0.22
16 0.18
17 0.14
18 0.12
19 0.11
20 0.11
21 0.11
22 0.12
23 0.15
24 0.17
25 0.17
26 0.18
27 0.19
28 0.21
29 0.26
30 0.24
31 0.21
32 0.2
33 0.19
34 0.19
35 0.17
36 0.16
37 0.1
38 0.08
39 0.07
40 0.06
41 0.05
42 0.04
43 0.09
44 0.08
45 0.09
46 0.09
47 0.09
48 0.1
49 0.11
50 0.11
51 0.08
52 0.08
53 0.09
54 0.14
55 0.16
56 0.16
57 0.15
58 0.15
59 0.14
60 0.15
61 0.13
62 0.1
63 0.08
64 0.08
65 0.09
66 0.1
67 0.1
68 0.1
69 0.11
70 0.12
71 0.12
72 0.13
73 0.12
74 0.11
75 0.11
76 0.1
77 0.09
78 0.07
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.09
85 0.11
86 0.13
87 0.15
88 0.16
89 0.16
90 0.19
91 0.22
92 0.23
93 0.21
94 0.2
95 0.19
96 0.23